Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SARS-CoV-2 Spike protein (S1) Tag-free

Source: Human cells. SARS-CoV-2 (Severe Acute Respiratory Syndrome Coronavirus 2) also known as 2019-nCoV (2019 Novel Coronavirus) is a virus that causes illnesses ranging from the common cold to severe diseases. SARS-CoV-2 Spike Protein is composed of S1 domain and S2 domain. S1 contains a receptor-binding domain (RBD) that can specifically bind to angiotensin-converting enzyme 2 (ACE2), the receptor on target cells. S protein plays an important role in the induction of neutralizing-antibodies and T-cell responses, as well as protective immunity. Predicted molecular weight 78.3 kDa.

Product Specifications

UniProt

QHD43416.1

Applications

Functional Assay, ELISA

Purification

> 85% as analyzed by SDS-PAGE

Format

Purified

Components

PBS, pH 7.4

Storage Conditions

The product can be stored at -20°C or below. Avoid repeated freezing and thawing cycles. The shelf life of the product is unspecified.

Applications Notes

ELISA, SARS-CoV-2 Spike protein (S1) can bind with Human ACE2 in functional ELISA assay.

Amino Acids

QCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRAR
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

2,3-Dichlorophenylacetic acid
419636-01 100 mg

2,3-Dichlorophenylacetic acid

Ask
View Details
2,3-Dichlorophenylacetic acid
419636-02 250 mg

2,3-Dichlorophenylacetic acid

Ask
View Details
Recombinant Human CXCL2 Protein
E30P12561 20 µg

Recombinant Human CXCL2 Protein

Ask
View Details
GSTA1 (Glutathione S-transferase A1, GST HA Subunit 1, GST Class-alpha Member 1, GST-epsilon, GSTA1-1, GTH1, MGC131939) (MaxLight 550)
MBS6380359-01 0.1 mL

GSTA1 (Glutathione S-transferase A1, GST HA Subunit 1, GST Class-alpha Member 1, GST-epsilon, GSTA1-1, GTH1, MGC131939) (MaxLight 550)

Ask
View Details
GSTA1 (Glutathione S-transferase A1, GST HA Subunit 1, GST Class-alpha Member 1, GST-epsilon, GSTA1-1, GTH1, MGC131939) (MaxLight 550)
MBS6380359-02 5x 0.1 mL

GSTA1 (Glutathione S-transferase A1, GST HA Subunit 1, GST Class-alpha Member 1, GST-epsilon, GSTA1-1, GTH1, MGC131939) (MaxLight 550)

Ask
View Details