Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HCV Genotype 1b, 170 a.a.

Source: Escherichia Coli.Sterile filtered colorless solution.HCV is a small 50nm, enveloped, single-stranded, positive sense RNAvirus in the family Flaviviridae. HCV has a high rate of replication with approximately one trillion particles produced each day in an infected individual. Due to lack of proofreading by the HCV RNA polymerase, the HCV has an exceptionally high mutation rate, a factor that may help it elude the host's immune response. Hepatitis C virus is classified into six genotypes (1-6) with several subtypes within each genotype. The preponderance and distribution of HCV genotypes varies globally. Genotype is clinically important in determining potential response to interferon-based therapy and the required duration of such therapy. Genotypes 1 and 4 are less responsive to interferon-based treatment than are the other genotypes (2, 3, 5 and 6) .Recombinant HCV Core genotype 1b produced in E.Coli containing 170 amino acids and purified by proprietary chromatographic techniques.

Product Specifications

Product Name Alternative

HCV is a small 50nm, enveloped, single-stranded, positive sense RNAvirus in the family Flaviviridae. HCV has a high rate of replication with approximately one trillion particles produced each day in an infected individual. Due to lack of proofreading by the HCV RNA polymerase, the HCV has an except

Purification

Greater than 95.0% as determined by SDS-PAGE.

Components

Sterile filtered solution containing 1x PBS and 25mM Arginine.

Storage Conditions

Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) . Avoid multiple freeze-thaw cycles.

Amino Acids

MKETAAAKFERQHMDSPDLGTLVPRGSMADIGSSTNPKPQRKTKRNTNRRPQDVKFPGGGQIVGGVYLLPRRGPRLGVRATRKTSERSQPRGWRQPIPKARRPEGRAWAQPGYPWPLYGNEGLGWAGWLLSPRGSRPSWGPTDPRRRSRNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPVDKLAAALEHHHHHH*
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human DSTN ELISA KIT
EF004857 96 Tests

Human DSTN ELISA KIT

Ask
View Details
FCAR, ID (FCAR, CD89, Immunoglobulin alpha Fc receptor, CD89) (FITC)
MBS6298585-01 0.2 mL

FCAR, ID (FCAR, CD89, Immunoglobulin alpha Fc receptor, CD89) (FITC)

Ask
View Details
FCAR, ID (FCAR, CD89, Immunoglobulin alpha Fc receptor, CD89) (FITC)
MBS6298585-02 5x 0.2 mL

FCAR, ID (FCAR, CD89, Immunoglobulin alpha Fc receptor, CD89) (FITC)

Ask
View Details
Recombinant Escherichia coli O157:H7 SsrA-binding protein (smpB)
MBS1214793-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O157:H7 SsrA-binding protein (smpB)

Ask
View Details
Recombinant Escherichia coli O157:H7 SsrA-binding protein (smpB)
MBS1214793-02 0.1 mg (E-Coli)

Recombinant Escherichia coli O157:H7 SsrA-binding protein (smpB)

Ask
View Details
Recombinant Escherichia coli O157:H7 SsrA-binding protein (smpB)
MBS1214793-03 0.02 mg (Yeast)

Recombinant Escherichia coli O157:H7 SsrA-binding protein (smpB)

Ask
View Details