Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gliadin Gamma Wheat

Source: Escherichia Coli.Sterile Filtered clear solution.Wheat Gliadin and related gluten components from barley, rye and possibly oats can cause an abnormal immune response called Celiac disease which is a chronic gastrointestinal disorder. Celiac disease characteristics are flattening of the jejunal mucosa and intestinal lesions of variable severity in hereditarily inclined individuals. Even though Celiac disease is not a classic autoimmune disease it is related to anti-tissue transglutaminase antibodies and gliadin antibodies tests are most recommended in screening populations at risk for CD and other gluten-sensitive enteropathies. In the past, serologic tests for gliadin antibodies usually were not very precise and were not enough for accurate diagnosis due to missing deamidated epitopes within the authentic gliadin fraction traditionally used in diagnostic test kits. ProSpec's deamidated Gliadin isoform matches to the deamidated neo-epitopes, which in the natural antigen are formed by transglutaminase-mediated glutamine side chain deamidation.Recombinant Wheat Gliadin Gamma protein produced in E.Coli and fused to a 6 His Tag at C-terminus, having a theoretical Mw of 37945.14 Dalton, pI 7.70.Purified by proprietary chromatographic technique.

Product Specifications

Product Name Alternative

Wheat Gliadin and related gluten components from barley, rye and possibly oats can cause an abnormal immune response called Celiac disease which is a chronic gastrointestinal disorder. Celiac disease characteristics are flattening of the jejunal mucosa and intestinal lesions of variable severity in

Purification

Protein is >90% pure.

Components

Gliadin Gamma protein solution (1mg/mL) in 10mM Tris-HCl pH 7.2.

Storage Conditions

Gliadin Gamma although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.

Amino Acids

MKTLLILTILAMAITIGTANIQVDPSGQVQWLQQQLVPQLQQPLSQQPQQTFPQPQQTFPHQPQQQVPQPQQPQQPFLQPQQPFPQQPQQPFPQTQQPQQPFPQQPQQPFPQTQQPQQPFPQQPQQPFPQTQQPQQPFPQLQQPQQPFPQPQQQLPQPQQPQQSFPQQQRPFIQPSLQQQLNCKNILLQQSKPASLVSSLWSIIWPQSDCQVMRQQCCQQLAQIPQQLQCAAIHSVVHSIIMQQQQQQQQQQGIDIFLPLSQHEQVGQGSLVQGQGIIQPQQPAQLEAIRSLVLQTLPSMCNVYVPPECSIMRAPFASIVAGIGGQHHHHHH.
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PPP1R9B (NM_032595) Human Tagged ORF Clone
RG213696 10 µg

PPP1R9B (NM_032595) Human Tagged ORF Clone

Ask
View Details
GDE1 antibody
70R-17452 50 ul

GDE1 antibody

Ask
View Details
Duck Ras-Related Protein Rab-3C (RAB3C) ELISA Kit
MBS9398778 Inquire

Duck Ras-Related Protein Rab-3C (RAB3C) ELISA Kit

Ask
View Details
Rabbit Polyclonal GW182 Antibody
NBP1-57134 100 µL

Rabbit Polyclonal GW182 Antibody

Ask
View Details
Rabbit Polyclonal SIPA1L2 Antibody [DyLight 550]
NBP1-77090R 0.1 mL

Rabbit Polyclonal SIPA1L2 Antibody [DyLight 550]

Ask
View Details