Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gliadin Gamma Wheat

Source: Escherichia Coli.Sterile Filtered clear solution.Wheat Gliadin and related gluten components from barley, rye and possibly oats can cause an abnormal immune response called Celiac disease which is a chronic gastrointestinal disorder. Celiac disease characteristics are flattening of the jejunal mucosa and intestinal lesions of variable severity in hereditarily inclined individuals. Even though Celiac disease is not a classic autoimmune disease it is related to anti-tissue transglutaminase antibodies and gliadin antibodies tests are most recommended in screening populations at risk for CD and other gluten-sensitive enteropathies. In the past, serologic tests for gliadin antibodies usually were not very precise and were not enough for accurate diagnosis due to missing deamidated epitopes within the authentic gliadin fraction traditionally used in diagnostic test kits. ProSpec's deamidated Gliadin isoform matches to the deamidated neo-epitopes, which in the natural antigen are formed by transglutaminase-mediated glutamine side chain deamidation.Recombinant Wheat Gliadin Gamma protein produced in E.Coli and fused to a 6 His Tag at C-terminus, having a theoretical Mw of 37945.14 Dalton, pI 7.70.Purified by proprietary chromatographic technique.

Product Specifications

Product Name Alternative

Wheat Gliadin and related gluten components from barley, rye and possibly oats can cause an abnormal immune response called Celiac disease which is a chronic gastrointestinal disorder. Celiac disease characteristics are flattening of the jejunal mucosa and intestinal lesions of variable severity in

Purification

Protein is >90% pure.

Components

Gliadin Gamma protein solution (1mg/mL) in 10mM Tris-HCl pH 7.2.

Storage Conditions

Gliadin Gamma although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.

Amino Acids

MKTLLILTILAMAITIGTANIQVDPSGQVQWLQQQLVPQLQQPLSQQPQQTFPQPQQTFPHQPQQQVPQPQQPQQPFLQPQQPFPQQPQQPFPQTQQPQQPFPQQPQQPFPQTQQPQQPFPQQPQQPFPQTQQPQQPFPQLQQPQQPFPQPQQQLPQPQQPQQSFPQQQRPFIQPSLQQQLNCKNILLQQSKPASLVSSLWSIIWPQSDCQVMRQQCCQQLAQIPQQLQCAAIHSVVHSIIMQQQQQQQQQQGIDIFLPLSQHEQVGQGSLVQGQGIIQPQQPAQLEAIRSLVLQTLPSMCNVYVPPECSIMRAPFASIVAGIGGQHHHHHH.
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

NSUN3 siRNA (Human)
MBS8236452-01 15 nmol

NSUN3 siRNA (Human)

Ask
View Details
NSUN3 siRNA (Human)
MBS8236452-02 30 nmol

NSUN3 siRNA (Human)

Ask
View Details
NSUN3 siRNA (Human)
MBS8236452-03 5x 30 nmol

NSUN3 siRNA (Human)

Ask
View Details
FAM171A2 Antibody - C-terminal region
MBS3218467-01 0.1 mL

FAM171A2 Antibody - C-terminal region

Ask
View Details
FAM171A2 Antibody - C-terminal region
MBS3218467-02 5x 0.1 mL

FAM171A2 Antibody - C-terminal region

Ask
View Details
MIR6801 Human MicroRNA Expression Plasmid (MI0022646)
SC402242 10 µg

MIR6801 Human MicroRNA Expression Plasmid (MI0022646)

Ask
View Details