Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lacritin/LACRT (N-6His)

Source : E. coli Extracellular glycoprotein lacritin (Lacritin) is a secreted protein which consists of 119 amino acids after cleavage of the N-terminal signal peptide and displays several predicted alpha helices, mostly in the C- terminal half. Lacritin is highly expressed in the lacrimal gland, localizes primarily to secretory granules and secretory fluid. Lacritin modulates lacrimal acinar cell secretion, promotes ductal cell proliferation, and stimulates signaling through tyrosine phosphorylation and release of calcium. Lacritin is thus a multifunctional prosecretory mitogen with cell survival activity. Natural or bacterial cleavage of lacritin releases a C-terminal fragment that is bactericidal. Lacritin cell targeting is dependent on the cell surface heparan sulfate proteoglycan syndecan-1 (SDC1) . Binding utilizes an enzyme-regulated 'off-on' switch in which active epithelial heparanase (HPSE) cleaves off heparan sulfate to expose a binding site in the N-terminal region of syndecan-1's core protein.

Product Specifications

Product Name Alternative

Extracellular Glycoprotein Lacritin, LACRT

UniProt

Q9GZZ8

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4

Shipping Conditions

Ambient

Amino Acids

Recombinant Human Lacritin is produced by our E.coli expression system and the target gene encoding Ala19-Ala138 is expressed with a 6His tag at the N-terminus. MHHHHHHASSDSTGADPAQEAGTSKPNEEISGPAEPASPPETTTTAQETSAAAVQGTAKVTSSRQELNPLKSIVEKSILLTEQALAKAGKGMHGGVPGGKQFIENGSEFAQKLLKKFSLLKPWA
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Gamma-tubulin complex component 5, Tubgcp5 ELISA KIT
ELI-48633m 96 Tests

Mouse Gamma-tubulin complex component 5, Tubgcp5 ELISA KIT

Ask
View Details
Human BS69 (ZMYND11) (NM_001202468) AAV Particle
RC232977A1V 250 µL

Human BS69 (ZMYND11) (NM_001202468) AAV Particle

Ask
View Details
FITC Inulin Conjugate
B2013634 5 mg

FITC Inulin Conjugate

Ask
View Details
GIT2 Antibody
A73712-100UL 100 µL

GIT2 Antibody

Ask
View Details
Wdr35 3'UTR Lenti-reporter-Luc Vector
50323084 1.0 µg

Wdr35 3'UTR Lenti-reporter-Luc Vector

Ask
View Details