Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lacritin/LACRT (N-6His)

Source : E. coli Extracellular glycoprotein lacritin (Lacritin) is a secreted protein which consists of 119 amino acids after cleavage of the N-terminal signal peptide and displays several predicted alpha helices, mostly in the C- terminal half. Lacritin is highly expressed in the lacrimal gland, localizes primarily to secretory granules and secretory fluid. Lacritin modulates lacrimal acinar cell secretion, promotes ductal cell proliferation, and stimulates signaling through tyrosine phosphorylation and release of calcium. Lacritin is thus a multifunctional prosecretory mitogen with cell survival activity. Natural or bacterial cleavage of lacritin releases a C-terminal fragment that is bactericidal. Lacritin cell targeting is dependent on the cell surface heparan sulfate proteoglycan syndecan-1 (SDC1) . Binding utilizes an enzyme-regulated 'off-on' switch in which active epithelial heparanase (HPSE) cleaves off heparan sulfate to expose a binding site in the N-terminal region of syndecan-1's core protein.

Product Specifications

Product Name Alternative

Extracellular Glycoprotein Lacritin, LACRT

UniProt

Q9GZZ8

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4

Shipping Conditions

Ambient

Amino Acids

Recombinant Human Lacritin is produced by our E.coli expression system and the target gene encoding Ala19-Ala138 is expressed with a 6His tag at the N-terminus. MHHHHHHASSDSTGADPAQEAGTSKPNEEISGPAEPASPPETTTTAQETSAAAVQGTAKVTSSRQELNPLKSIVEKSILLTEQALAKAGKGMHGGVPGGKQFIENGSEFAQKLLKKFSLLKPWA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD5 (Cris-1), CF488A conjugate, 0.1mg/mL
BNC880176-500 1x 500 µL

CD5 (Cris-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF740 conjugate, 0.1mg/mL
BNC740026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF700 conjugate, 0.1mg/mL
BNC000437-100 1x 100 µL

CD47 (B6H12.2), CF700 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF640R conjugate, 0.1mg/mL
BNC400994-100 1x 100 µL

TNF alpha (J2D10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF680 conjugate, 0.1mg/mL
BNC801037-100 1x 100 µL

CD44 Standard (DF1485), CF680 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF640R conjugate, 0.1mg/mL
BNC400977-100 1x 100 µL

TGF-beta (1D11.16.8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details