Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lacritin/LACRT (N-6His)

Source : E. coli Extracellular glycoprotein lacritin (Lacritin) is a secreted protein which consists of 119 amino acids after cleavage of the N-terminal signal peptide and displays several predicted alpha helices, mostly in the C- terminal half. Lacritin is highly expressed in the lacrimal gland, localizes primarily to secretory granules and secretory fluid. Lacritin modulates lacrimal acinar cell secretion, promotes ductal cell proliferation, and stimulates signaling through tyrosine phosphorylation and release of calcium. Lacritin is thus a multifunctional prosecretory mitogen with cell survival activity. Natural or bacterial cleavage of lacritin releases a C-terminal fragment that is bactericidal. Lacritin cell targeting is dependent on the cell surface heparan sulfate proteoglycan syndecan-1 (SDC1) . Binding utilizes an enzyme-regulated 'off-on' switch in which active epithelial heparanase (HPSE) cleaves off heparan sulfate to expose a binding site in the N-terminal region of syndecan-1's core protein.

Product Specifications

Product Name Alternative

Extracellular Glycoprotein Lacritin, LACRT

UniProt

Q9GZZ8

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4

Shipping Conditions

Ambient

Amino Acids

Recombinant Human Lacritin is produced by our E.coli expression system and the target gene encoding Ala19-Ala138 is expressed with a 6His tag at the N-terminus. MHHHHHHASSDSTGADPAQEAGTSKPNEEISGPAEPASPPETTTTAQETSAAAVQGTAKVTSSRQELNPLKSIVEKSILLTEQALAKAGKGMHGGVPGGKQFIENGSEFAQKLLKKFSLLKPWA
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ASTL (Biotin)
555765-01 50 µg

ASTL (Biotin)

Ask
View Details
ASTL (Biotin)
555765-02 100 µg

ASTL (Biotin)

Ask
View Details
Tnpo2 ORF Vector (Mouse) (pORF)
47256014 1.0 µg DNA

Tnpo2 ORF Vector (Mouse) (pORF)

Ask
View Details
Human Tryptophane (TRP) Elisa Kit
EK710650 96 Well

Human Tryptophane (TRP) Elisa Kit

Ask
View Details
4-Hydroxytamoxifen 50mg
A20955-50 50 mg

4-Hydroxytamoxifen 50mg

Ask
View Details
Recombinant Escherichia coli O6 L-arabinose isomerase (araA)
MBS1285551-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O6 L-arabinose isomerase (araA)

Ask
View Details