Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Angiopoietin-like Protein 3/ANGPTL3 (C-6His)

Source: Human Cells. MW :24.6kD. Recombinant Human Angiopoietin-related Protein 3 is produced by our expression system and the target gene encoding Ser17-Pro220 is expressed Angiopoietin-like 3 (ANGPTL3) is a secreted glycoprotein that is structurally related to the angiopoietins. Mature human ANGPTL3 contains an N-terminal coiled coil domain and a C-terminal fibrinogen-like domain. ANGPTL3 is expressed in the liver from early in development through adulthood. Full length ANGPTL3 circulates in the plasma as do the proteolytically separated N-and C-terminal segments containing the coiled coil domain and fibrinogen-like domains, respectively. ANGPTL3 directly inhibits lipoprotein lipase (LPL) and endothelial lipase (EL), enzymes responsible for hydrolyzing circulating triglycerides and HDL phospholipids. ANGPTL3 promotes an increase in circulating triglyceride levels without altering VLDL or HDL secretion or uptake. ANGPTL3 expression in vivo is up-regulated by LXR agonists and down-regulated by insulin, leptin, and agonists of TR beta or PPAR beta.

Product Specifications

Gene Name

ANGPTL3

Gene ID

27329

UniProt

Q9Y5C1

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

SRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Exicorilant 100mg
A18620-100 100 mg

Exicorilant 100mg

Ask
View Details
FITC-Linked Polyclonal Antibody to Thrombospondin 1 (THBS1)
MBS2044993-01 0.1 mL

FITC-Linked Polyclonal Antibody to Thrombospondin 1 (THBS1)

Ask
View Details
FITC-Linked Polyclonal Antibody to Thrombospondin 1 (THBS1)
MBS2044993-02 0.2 mL

FITC-Linked Polyclonal Antibody to Thrombospondin 1 (THBS1)

Ask
View Details
FITC-Linked Polyclonal Antibody to Thrombospondin 1 (THBS1)
MBS2044993-03 0.5 mL

FITC-Linked Polyclonal Antibody to Thrombospondin 1 (THBS1)

Ask
View Details
FITC-Linked Polyclonal Antibody to Thrombospondin 1 (THBS1)
MBS2044993-04 1 mL

FITC-Linked Polyclonal Antibody to Thrombospondin 1 (THBS1)

Ask
View Details
FITC-Linked Polyclonal Antibody to Thrombospondin 1 (THBS1)
MBS2044993-05 5 mL

FITC-Linked Polyclonal Antibody to Thrombospondin 1 (THBS1)

Ask
View Details