Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-2 Receptor Subunit Gamma/IL-2 R gamma/CIDX (C-Fc)

Source: Human Cells. MW :55.1kD. Recombinant Mouse Interleukin-2 Receptor Subunit Gamma is produced by our Mammalian expression system and the target gene encoding Ser25-Ala263 is expressed with a Fc tag at the C-terminus. The Interleukin-2 receptor gamma chain (IL-2 R gamma , CD132) of the high affinity functional mouse IL-2 receptor complex is a member the hematopoietin receptor family. It is expressed on most lymphocyte (white blood cell) populations, and its gene is found on the X-chromosome of mammals. Common IL2 receptor- gamma Chain is required for IL-2 receptor signaling. Besides IL-2, the Common IL2 receptor- gamma chain has been shown to be a component of the functional receptor complexes for IL-4, IL-7, IL-9 and IL-15. It is a component of multiple cytokine receptors that are essential for lymphocyte development and function. Common IL2 receptor- gamma Chain is also designated the common gamma chain.

Product Specifications

Gene Name

Il2rg

Gene ID

16186

UniProt

Q3UPA9

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

SKVLMSSANEDIKADLILTSTAPEHLSAPTLPLPEVQCFVFNIEYMNCTWNSSSEPQATNLTLHYRYKVSDNNTFQECSHYLFSKEITSGCQIQKEDIQLYQTFVVQLQDPQKPQRRAVQKLNLQNLVIPRAPENLTLSNLSESQLELRWKSRHIKERCLQYLVQYRSNRDRSWTELIVNHEPRFSLPSVDELKRYTFRVRSRYNPICGSSQQWSKWSQPVHWGSHTVEENPSLFALEAVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral human PCDHGC3 shRNA (UAS) - Lentiviral human PCDHGC3 shRNA (UAS, iRFP) (25)
GTR15118442 1 Vial

Lentiviral human PCDHGC3 shRNA (UAS) - Lentiviral human PCDHGC3 shRNA (UAS, iRFP) (25)

Ask
View Details
Eukaryotic S100 Calcium Binding Protein (S100)
SFPA604Hu61-01 10 µg

Eukaryotic S100 Calcium Binding Protein (S100)

Ask
View Details
Eukaryotic S100 Calcium Binding Protein (S100)
SFPA604Hu61-02 50 µg

Eukaryotic S100 Calcium Binding Protein (S100)

Ask
View Details
Eukaryotic S100 Calcium Binding Protein (S100)
SFPA604Hu61-03 200 µg

Eukaryotic S100 Calcium Binding Protein (S100)

Ask
View Details
Eukaryotic S100 Calcium Binding Protein (S100)
SFPA604Hu61-04 1 mg

Eukaryotic S100 Calcium Binding Protein (S100)

Ask
View Details
Eukaryotic S100 Calcium Binding Protein (S100)
SFPA604Hu61-05 5 mg

Eukaryotic S100 Calcium Binding Protein (S100)

Ask
View Details