Recombinant Mouse Kallikrein 1/mGK-6 (C-6His)

Source: Human Cells. MW :27.9kD. Recombinant Mouse Kallikrein-1 is produced by our Mammalian expression system and the target gene encoding Pro19-Asp261 is expressed with a 6His tag at the C-terminus. Kallikreins belongs to the family of trypsin-like serine proteases, many of which are associated with a variety of cancers. Kallikrein 1 (KLK1) is also known as tissue kallikrein and urinary kallikrein. KLK1 is synthesized as a 261 amino acid (aa) protein that contains a 18 aa signal peptide and a 241 aa proprotein. An important physiological function of KLK1 cleaves Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin. Kinins regulate vasodilation, blood pressure reduction, smooth muscle relaxation and contraction, pain induction and inflammation.

Product Specifications

Gene Name

Klk1

Gene ID

16612

UniProt

P15947

Components

Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl, pH7.5.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

PPVQSRIVGGFNCEKNSQPWQVAVYRFTKYQCGGILLNANWVLTAAHCHNDKYQVWLGKNNFLEDEPSAQHRLVSKAIPHPDFNMSLLNEHTPQPEDDYSNDLMLLRLKKPADITDVVKPIDLPTEEPKLGSTCLASGWGSITPVKYEYPDELQCVNLKLLPNEDCAKAHIEKVTDDMLCAGDMDGGKDTCAGDSGGPLICDGVLQGITSWGPSPCGKPNVPGIYTRVLNFNTWIRETMAENDVDHHHHHH