Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human LAG-3/CD233 (Leu23-Leu450)

Source: Human Cells. MW :47.2kD. Recombinant Human Lymphocyte Activation Gene 3 Protein is produced by our Mammalian expression system and the target gene encoding Leu23-Leu450 is expressed with a 6His tag at the C-terminus. Human Lymphocyte activation gene 3 protein (LAG3) is a member of immunoglobulin (Ig) superfamily. LAG3 contains 4 extracellular Ig-like domains. The LAG3 gene contains 8 exons. LAG3 is involved in lymphocyte activation and can bind to HLA class-II antigens. It is selectively expressed in activated T and NK cells. LAG3 has a negative regulatory function in T cells and acts as as a new marker of T cell induced B cell activation. As a soluble molecule, LAG3 activates antigen-presenting cells through MHC class II signaling. It can lead to increased antigen-specific T-cell responses in vivo. LAG-3 has higher affinity to MHC class II than CD4.

Product Specifications

Gene Name

LAG3

Gene ID

3902

UniProt

P18627

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

LQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-DNMT1 Antibody
12595-1 100 µg

Anti-DNMT1 Antibody

Ask
View Details
CCDC83 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-8087R-BF750 100 µL

CCDC83 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Ask
View Details
Eucalyptol
MBS3604565-01 50 mg

Eucalyptol

Ask
View Details
Eucalyptol
MBS3604565-02 5x 50 mg

Eucalyptol

Ask
View Details
pExpress-1-Spata1 Plasmid
PVT42665 2 µg

pExpress-1-Spata1 Plasmid

Ask
View Details
HSD17B3 Polyclonal Conjugated Antibody
MBS9442477-01 0.1 mL (Biotin)

HSD17B3 Polyclonal Conjugated Antibody

Ask
View Details