Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Dermatopontin/DPT (C-Fc)

Source: Human Cells. MW :49.1kD. Recombinant Mouse Dermatopontin is produced by our Mammalian expression system and the target gene encoding Gln19-Val201 is expressed with a Fc tag at the C-terminus. Dermatopontin is a widely expressed noncollagenous protein component of the extracellular matrix. It is a 22 kDa molecule that is tyrosine sulfated but not glycosylated. Dermatopontin is down regulated in fibrotic growths such as leiomyoma and scar tissue, inhibits cell proliferation, accelerates collagen fibril formation, and stabilizes collagen fibrils against low-temperature dissociation, Dermatopontin deficient mice exhibit altered collagen matrix deposition and organization. Dermatopontin seems to mediate adhesion by cell surface integrin binding, may serve as a communication link between the dermal fibroblast cell surface and its extracellular matrix environment, and enhances TGFB1 activity (By similarity) . Dermatopontin promotes bone mineralization under the control of the vitamin D receptor and inhibits BMP-2 effects on osteoblast precursors.

Product Specifications

Gene Name

Dpt

Gene ID

56429

UniProt

Q9QZZ6

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

QYGGYGYPYQQYQDYGDDGWVNLNRQGFSYQCPHGQVVVAVRSIFSKKEGSDRQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQKCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCPYSCWMTTEYPSHYGEDMDMISYDYDFYMRGATTTFSAVERDRQWKFIMCRMTDYDCEFENVVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
More Discoveries

Explore Other Products

Browse additional items from our catalog

NATtrol Norovirus Group II (Recombinant) Stock
NATNOVII-ST 1 mL

NATtrol Norovirus Group II (Recombinant) Stock

Sign In for Pricing
View Details
Phospho-Akt1 (Tyr474) Colorimetric Cell-Based ELISA Kit
MBS9501177-01 1 Kit

Phospho-Akt1 (Tyr474) Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details
Phospho-Akt1 (Tyr474) Colorimetric Cell-Based ELISA Kit
MBS9501177-02 5x 1 Kit

Phospho-Akt1 (Tyr474) Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details
MX1 Human shRNA Lentiviral Particle (Locus ID 4599)
TL315502V 500 µL Each

MX1 Human shRNA Lentiviral Particle (Locus ID 4599)

Sign In for Pricing
View Details
Lithium acetate
JH335943 1 Each

Lithium acetate

Sign In for Pricing
View Details
UBA6 CytoSection
TS414483P5 25 Slides

UBA6 CytoSection

Sign In for Pricing
View Details