Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Dermatopontin/DPT (C-Fc)

Source: Human Cells. MW :49.1kD. Recombinant Mouse Dermatopontin is produced by our Mammalian expression system and the target gene encoding Gln19-Val201 is expressed with a Fc tag at the C-terminus. Dermatopontin is a widely expressed noncollagenous protein component of the extracellular matrix. It is a 22 kDa molecule that is tyrosine sulfated but not glycosylated. Dermatopontin is down regulated in fibrotic growths such as leiomyoma and scar tissue, inhibits cell proliferation, accelerates collagen fibril formation, and stabilizes collagen fibrils against low-temperature dissociation, Dermatopontin deficient mice exhibit altered collagen matrix deposition and organization. Dermatopontin seems to mediate adhesion by cell surface integrin binding, may serve as a communication link between the dermal fibroblast cell surface and its extracellular matrix environment, and enhances TGFB1 activity (By similarity) . Dermatopontin promotes bone mineralization under the control of the vitamin D receptor and inhibits BMP-2 effects on osteoblast precursors.

Product Specifications

Gene Name

Dpt

Gene ID

56429

UniProt

Q9QZZ6

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

QYGGYGYPYQQYQDYGDDGWVNLNRQGFSYQCPHGQVVVAVRSIFSKKEGSDRQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQKCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCPYSCWMTTEYPSHYGEDMDMISYDYDFYMRGATTTFSAVERDRQWKFIMCRMTDYDCEFENVVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Fcrl5 (NM_001113238) Mouse Tagged ORF Clone Lentiviral Particle
MR226286L4V 200 µL

Fcrl5 (NM_001113238) Mouse Tagged ORF Clone Lentiviral Particle

Ask
View Details
Phospho-MTOR (S2481) Antibody
A74805-50UL 50 μL

Phospho-MTOR (S2481) Antibody

Ask
View Details
Mouse Monoclonal NAALADase-like 2/NAALADL2 Antibody (817225) [Janelia Fluor 549]
FAB4665I 0.1 mL

Mouse Monoclonal NAALADase-like 2/NAALADL2 Antibody (817225) [Janelia Fluor 549]

Ask
View Details
Yeast Abiotic-Stress Resistance Gene Screening Vector Kit
RY8013 1 Each

Yeast Abiotic-Stress Resistance Gene Screening Vector Kit

Ask
View Details
Rpp30 shRNA (h) Lentiviral Particles
sc-38352-V 200 µL

Rpp30 shRNA (h) Lentiviral Particles

Ask
View Details
Human PRSS53 Knockout HEK293T cell line
GTR15413125 1 Vial

Human PRSS53 Knockout HEK293T cell line

Ask
View Details