Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Serpin A12/Vaspin (C-10His)

Source: Human Cells. MW :46.5kD. Recombinant Human Serpin A12 is produced by our Mammalian expression system and the target gene encoding Leu21-Lys414 is expressed with a 10His tag at the C-terminus. Vaspin (Visceral Adipose-Specific SERPIN) is a newly described adipokine. Vaspin has three beta-sheets, nine a-helices, and one central loop; the structure is part of the set of distinctive features that are descriptive of Serpin family members. Vaspin is also a unique insulin sensitizing adipocytokine in obesity. A recent publication indicates that Vaspin mRNA expression in visceral fat is positively correlated with BMI and percent of body fat. and could be associated with parameters of obesity, insulin resistance, and glucose metabolism. These findings suggest a potential clinical use for Vaspin in ameliorating certain aberrations seen in the obesity metabolic syndrome.

Product Specifications

Gene Name

SERPINA12

Gene ID

145264

UniProt

Q8IW75

Components

Supplied as a 0.2 μm filtered solution of 20mM Tris, 150mM NaCl, pH7.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

LKPSFSPRNYKALSEVQGWKQRMAAKELARQNMDLGFKLLKKLAFYNPGRNIFLSPLSISTAFSMLCLGAQDSTLDEIKQGFNFRKMPEKDLHEGFHYIIHELTQKTQDLKLSIGNTLFIDQRLQPQRKFLEDAKNFYSAETILTNFQNLEMAQKQINDFISQKTHGKINNLIENIDPGTVMLLANYIFFRARWKHEFDPNVTKEEDFFLEKNSSVKVPMMFRSGIYQVGYDDKLSCTILEIPYQKNITAIFILPDEGKLKHLEKGLQVDTFSRWKTLLSRRVVDVSVPRLHMTGTFDLKKTLSYIGVSKIFEEHGDLTKIAPHRSLKVGEAVHKAELKMDERGTEGAAGTGAQTLPMETPLVVKIDKPYLLLIYSEKIPSVLFLGKIVNPIGKHHHHHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Phospho1 (NM_001105833) Rat Tagged Lenti ORF Clone
RR207056L3 10 µg

Phospho1 (NM_001105833) Rat Tagged Lenti ORF Clone

Ask
View Details
Rat S100A16 (S100 Calcium Binding Protein A16) ELISA Kit
EK246834 96 Well

Rat S100A16 (S100 Calcium Binding Protein A16) ELISA Kit

Ask
View Details
Tubulin beta-3 Chain (Tubulin beta-III, TUBB3, Tubulin beta-4 Chain, TUBB4, CDCBM, beta-4, CFEOM3A) (MaxLight 550)
MBS6397541-01 0.1 mL

Tubulin beta-3 Chain (Tubulin beta-III, TUBB3, Tubulin beta-4 Chain, TUBB4, CDCBM, beta-4, CFEOM3A) (MaxLight 550)

Ask
View Details
Tubulin beta-3 Chain (Tubulin beta-III, TUBB3, Tubulin beta-4 Chain, TUBB4, CDCBM, beta-4, CFEOM3A) (MaxLight 550)
MBS6397541-02 5x 0.1 mL

Tubulin beta-3 Chain (Tubulin beta-III, TUBB3, Tubulin beta-4 Chain, TUBB4, CDCBM, beta-4, CFEOM3A) (MaxLight 550)

Ask
View Details
Acidize Orcein Alcoholic Solution, 1%
G1922 50 mL

Acidize Orcein Alcoholic Solution, 1%

Ask
View Details
BM-1197
MF-0038112 5 mg

BM-1197

Ask
View Details