Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T-cell Immunoglobulin and Mucin Domain-containing Protein 4/Tim-4 (C-6His)

Source: Human Cells. MW :32.3kD. Recombinant Human T-cell Immunoglobulin and Mucin Domain-containing Protein 4 is produced by our Mammalian expression system and the target gene encoding Glu25-Leu315 is expressed with a 6His tag at the C-terminus. T-cell Immunoglobulin and Mucin Domain-containing Protein 4 (TIM-4) belongs to the immunoglobulin superfamily, is a member of the TIM family of immune regulating proteins. TIMs are type I transmembrane proteins with one Ig-like V domain and one Ser/Thr-rich mucin domain. Structurally, TIM-4 is distinguished from other TIMs by the presence of an RGD motif in its Ig domain and the lack of a site for tyrosine phosphorylation in its cytoplasmic tail. The mucin domain in TIM-4 is larger than in TIM-1 or TIM-3. TIM-4 is expressed by macrophages and mature dendritic cells but not by lymphocytes. it is Involved in regulating T-cell proliferation and lymphotoxin signaling.The interaction of TIM-4 with TIM-1 induces costimulatory and hyperproliferative signals in T cells. TIM-4 binds specifically to TIM-1 which is also the cellular receptor for the hepatitis A virus, and has been implicated in the development of asthma.

Product Specifications

Gene Name

TIMD4

Gene ID

91937

UniProt

Q96H15

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

ETVVTEVLGHRVTLPCLYSSWSHNSNSMCWGKDQCPYSGCKEALIRTDGMRVTSRKSAKYRLQGTIPRGDVSLTILNPSESDSGVYCCRIEVPGWFNDVKINVRLNLQRASTTTHRTATTTTRRTTTTSPTTTRQMTTTPAALPTTVVTTPDLTTGTPLQMTTIAVFTTANTCLSLTPSTLPEEATGLLTPEPSKEGPILTAESETVLPSDSWSSAESTSADTVLLTSKESKVWDLPSTSHVSMWKTSDSVSSPQPGASDTAVPEQNKTTKTGQMDGIPMSMKNEMPISQLHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Synaptotagmin I (SYT1, DKFZp781D2042, p65, P65, SVP65, Synaptotagmin-1, SYT, SytI)
S9109-19A 100 µg

Synaptotagmin I (SYT1, DKFZp781D2042, p65, P65, SVP65, Synaptotagmin-1, SYT, SytI)

Ask
View Details
[ (pF) Phe4]Nociceptin (1-13) NH2 acetate
MF-0097334-01 1 mg

[ (pF) Phe4]Nociceptin (1-13) NH2 acetate

Ask
View Details
[ (pF) Phe4]Nociceptin (1-13) NH2 acetate
MF-0097334-02 2 mg

[ (pF) Phe4]Nociceptin (1-13) NH2 acetate

Ask
View Details
[ (pF) Phe4]Nociceptin (1-13) NH2 acetate
MF-0097334-03 5 mg

[ (pF) Phe4]Nociceptin (1-13) NH2 acetate

Ask
View Details
[ (pF) Phe4]Nociceptin (1-13) NH2 acetate
MF-0097334-04 10 mg

[ (pF) Phe4]Nociceptin (1-13) NH2 acetate

Ask
View Details
[ (pF) Phe4]Nociceptin (1-13) NH2 acetate
MF-0097334-05 25 mg

[ (pF) Phe4]Nociceptin (1-13) NH2 acetate

Ask
View Details