Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse CD160 (C-6His)

Source: Human Cells. MW :15.8kD. Recombinant Mouse CD160 Antigen is produced by our Mammalian expression system and the target gene encoding Gly28-Ser160 is expressed with a 6His tag at the C-terminus. CD160 antigen is a cell membrane protein which contains one Ig-likeV-type (immunoglobulin-like) domain. CD160 is a GPI-anchored lymphocyte surface receptor in which expression is mostly restricted to the highly cytotoxic CD56 (dim) CD16 (+) peripheral blood NK subset. CD160 is a receptor showing broad specificity for both classical and non-classical MHC class I molecules. CD160 is expressed in spleen, peripheral blood, and smal lintestine. Expression of CD160 is restricted to functional NK and T cytotoxic lymphocytes. CD160 acts as a co-activator receptor for CD3-induced proliferation of CD4+ CD160+ T cells isolated from inflammatory skin lesions. Activated NK lymphocytes release a soluble form of CD160 that functionally impairs the MHC-I-specific cytotoxic CD8 (+) T lymphocyte responsiveness.

Product Specifications

Gene Name

Cd160

UniProt

Q8VC80

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GCIHVTSSASQKGGRLDLTCTLWHKKDEAEGLILFWCKDNPWNCSPETSLEQLRVKRDPETDGITEKSSQLVFTIEQATPSDSGTYQCCARSQKPEIYIHGHFLSVLVTGNHTEIRQRQRSHPDFSHINGTLSHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Youlemycin
MF-0092667 25 mg

Youlemycin

Ask
View Details
Rabbit Monoclonal EphB4 Antibody (201) [Biotin]
NBP2-89354B 0.1 mL

Rabbit Monoclonal EphB4 Antibody (201) [Biotin]

Ask
View Details
FSCN3, CT (FSCN3, Fascin-3, Testis fascin) (Biotin)
MBS6300193-01 0.2 mL

FSCN3, CT (FSCN3, Fascin-3, Testis fascin) (Biotin)

Ask
View Details
FSCN3, CT (FSCN3, Fascin-3, Testis fascin) (Biotin)
MBS6300193-02 5x 0.2 mL

FSCN3, CT (FSCN3, Fascin-3, Testis fascin) (Biotin)

Ask
View Details
Glutathione S-Transferase Class-Mu 26 KDa Isozyme (GST) Antibody
abx404491-01 100 µL

Glutathione S-Transferase Class-Mu 26 KDa Isozyme (GST) Antibody

Ask
View Details
Glutathione S-Transferase Class-Mu 26 KDa Isozyme (GST) Antibody
abx404491-02 200 µL

Glutathione S-Transferase Class-Mu 26 KDa Isozyme (GST) Antibody

Ask
View Details