Recombinant Mouse CD160 (C-6His)
Source: Human Cells. MW :15.8kD. Recombinant Mouse CD160 Antigen is produced by our Mammalian expression system and the target gene encoding Gly28-Ser160 is expressed with a 6His tag at the C-terminus. CD160 antigen is a cell membrane protein which contains one Ig-likeV-type (immunoglobulin-like) domain. CD160 is a GPI-anchored lymphocyte surface receptor in which expression is mostly restricted to the highly cytotoxic CD56 (dim) CD16 (+) peripheral blood NK subset. CD160 is a receptor showing broad specificity for both classical and non-classical MHC class I molecules. CD160 is expressed in spleen, peripheral blood, and smal lintestine. Expression of CD160 is restricted to functional NK and T cytotoxic lymphocytes. CD160 acts as a co-activator receptor for CD3-induced proliferation of CD4+ CD160+ T cells isolated from inflammatory skin lesions. Activated NK lymphocytes release a soluble form of CD160 that functionally impairs the MHC-I-specific cytotoxic CD8 (+) T lymphocyte responsiveness.
Product Specifications
Gene Name
Cd160
UniProt
Q8VC80
Components
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
GCIHVTSSASQKGGRLDLTCTLWHKKDEAEGLILFWCKDNPWNCSPETSLEQLRVKRDPETDGITEKSSQLVFTIEQATPSDSGTYQCCARSQKPEIYIHGHFLSVLVTGNHTEIRQRQRSHPDFSHINGTLSHHHHHH
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items