Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Phospholipase A2 Group IB/PLA2G1B (C-6His)

Source: Human Cells. MW :15.6kD. Recombinant Mouse Phospholipase A2 is produced by our Mammalian expression system and the target gene encoding Ala16-Cys146 is expressed with a 6His tag at the C-terminus. Mouse phospholipase A2 is a secreted protein which belongs to the phospholipase A2 family. Phospholipase A2/PLA2G1B catalyzes the release of fatty acids from glycero-3-phosphocholines. The best known varieties are the digestive enzymes secreted as zymogens by the pancreas of mammals. PLA2G1B has been thought to play major role in digestion of glycerophospholipids in nutrients, given its abundance in digestive organs. Since its expression has been observed in non-digestive organs including the lung, spleen, kidney, ovary, retina, brain, and neurons, its function may not limited to digestive role. PLA2G1B are resistant to obesity and diabetes induced by feeding a diabetogenic high-fat/high-carbohydrate diet. PLA2G1B inhibition may be a potentially effective oral therapeutic option for treatment of obesity and diabetes.

Product Specifications

Gene Name

Pla2g1b

Gene ID

18778

UniProt

Q9Z0Y2

Components

Supplied as a 0.2 μm filtered solution of 20mM HEPES,150mM NaCl, pH 7.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

AHSISPRAVWQFRNMIKCTIPGSDPLKDYNNYGCYCGLGGWGTPVDDLDRCCQTHDHCYSQAKKLESCKFLIDNPYTNTYSYSCSGSEITCSAKNNKCEDFICNCDREAAICFSKVPYNKEYKNLDTGKFCHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-Human CLDN9 Polyclonal Antibody
HF509014-01 50 µg

Anti-Human CLDN9 Polyclonal Antibody

Ask
View Details
Anti-Human CLDN9 Polyclonal Antibody
HF509014-02 100 µg

Anti-Human CLDN9 Polyclonal Antibody

Ask
View Details
Recombinant Human Annexin A13/ANXA13 Protein
E53A05407 50 µg

Recombinant Human Annexin A13/ANXA13 Protein

Ask
View Details
Human NDUFB4 knockout cell line
ABC-KH9969 1 Vial

Human NDUFB4 knockout cell line

Ask
View Details
IL12A Monoclonal Antibody
TA399178 100 µg

IL12A Monoclonal Antibody

Ask
View Details
Danusertib
MF-0006322-01 2 mg

Danusertib

Ask
View Details