Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Phospholipase A2 Group IB/PLA2G1B (C-6His)

Source: Human Cells. MW :15.6kD. Recombinant Mouse Phospholipase A2 is produced by our Mammalian expression system and the target gene encoding Ala16-Cys146 is expressed with a 6His tag at the C-terminus. Mouse phospholipase A2 is a secreted protein which belongs to the phospholipase A2 family. Phospholipase A2/PLA2G1B catalyzes the release of fatty acids from glycero-3-phosphocholines. The best known varieties are the digestive enzymes secreted as zymogens by the pancreas of mammals. PLA2G1B has been thought to play major role in digestion of glycerophospholipids in nutrients, given its abundance in digestive organs. Since its expression has been observed in non-digestive organs including the lung, spleen, kidney, ovary, retina, brain, and neurons, its function may not limited to digestive role. PLA2G1B are resistant to obesity and diabetes induced by feeding a diabetogenic high-fat/high-carbohydrate diet. PLA2G1B inhibition may be a potentially effective oral therapeutic option for treatment of obesity and diabetes.

Product Specifications

Gene Name

Pla2g1b

Gene ID

18778

UniProt

Q9Z0Y2

Components

Supplied as a 0.2 μm filtered solution of 20mM HEPES,150mM NaCl, pH 7.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

AHSISPRAVWQFRNMIKCTIPGSDPLKDYNNYGCYCGLGGWGTPVDDLDRCCQTHDHCYSQAKKLESCKFLIDNPYTNTYSYSCSGSEITCSAKNNKCEDFICNCDREAAICFSKVPYNKEYKNLDTGKFCHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Ribonuclease ZC3H12A (ZC3H12A) ELISA Kit
orb2657193-01 48 Tests

Human Ribonuclease ZC3H12A (ZC3H12A) ELISA Kit

Sign In for Pricing
View Details
Human Ribonuclease ZC3H12A (ZC3H12A) ELISA Kit
orb2657193-02 96 Tests

Human Ribonuclease ZC3H12A (ZC3H12A) ELISA Kit

Sign In for Pricing
View Details
DIDO1 Antibody
orb520641-01 50 μL

DIDO1 Antibody

Sign In for Pricing
View Details
DIDO1 Antibody
orb520641-02 100 µL

DIDO1 Antibody

Sign In for Pricing
View Details
2- ((2,4-dichlorophenyl) sulfonyl) -3,3-dimethylthioprop-2-enenitrile
ZQB35341 250 mg

2- ((2,4-dichlorophenyl) sulfonyl) -3,3-dimethylthioprop-2-enenitrile

Sign In for Pricing
View Details
APC_Cy7 Linked Polyclonal Antibody to Cytochrome P450 3A2 (CYP3A2)
MBS2132410-01 0.1 mL

APC_Cy7 Linked Polyclonal Antibody to Cytochrome P450 3A2 (CYP3A2)

Sign In for Pricing
View Details