Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Phospholipase A2 Group IB/PLA2G1B (C-6His)

Source: Human Cells. MW :15.6kD. Recombinant Mouse Phospholipase A2 is produced by our Mammalian expression system and the target gene encoding Ala16-Cys146 is expressed with a 6His tag at the C-terminus. Mouse phospholipase A2 is a secreted protein which belongs to the phospholipase A2 family. Phospholipase A2/PLA2G1B catalyzes the release of fatty acids from glycero-3-phosphocholines. The best known varieties are the digestive enzymes secreted as zymogens by the pancreas of mammals. PLA2G1B has been thought to play major role in digestion of glycerophospholipids in nutrients, given its abundance in digestive organs. Since its expression has been observed in non-digestive organs including the lung, spleen, kidney, ovary, retina, brain, and neurons, its function may not limited to digestive role. PLA2G1B are resistant to obesity and diabetes induced by feeding a diabetogenic high-fat/high-carbohydrate diet. PLA2G1B inhibition may be a potentially effective oral therapeutic option for treatment of obesity and diabetes.

Product Specifications

Gene Name

Pla2g1b

Gene ID

18778

UniProt

Q9Z0Y2

Components

Supplied as a 0.2 μm filtered solution of 20mM HEPES,150mM NaCl, pH 7.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

AHSISPRAVWQFRNMIKCTIPGSDPLKDYNNYGCYCGLGGWGTPVDDLDRCCQTHDHCYSQAKKLESCKFLIDNPYTNTYSYSCSGSEITCSAKNNKCEDFICNCDREAAICFSKVPYNKEYKNLDTGKFCHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Decaprenyl-diphosphate synthase subunit 2 (PDSS2) Antibody
abx211176-01 50 µL

Decaprenyl-diphosphate synthase subunit 2 (PDSS2) Antibody

Ask
View Details
Decaprenyl-diphosphate synthase subunit 2 (PDSS2) Antibody
abx211176-02 100 µL

Decaprenyl-diphosphate synthase subunit 2 (PDSS2) Antibody

Ask
View Details
anti-TIPIN
YF-PA19477 50 ug

anti-TIPIN

Ask
View Details
ALDH2, NT (Aldehyde Dehydrogenase, Mitochondrial, EC 1.2.1.3, ALDH Class 2, ALDHI, ALDH-E2, ALDM) (MaxLight 550) discontinued
A1334-34A-ML550 100 µL

ALDH2, NT (Aldehyde Dehydrogenase, Mitochondrial, EC 1.2.1.3, ALDH Class 2, ALDHI, ALDH-E2, ALDM) (MaxLight 550) discontinued

Ask
View Details
Human Toll Like Receptor Adaptor Molecule 1 (TICAM1) ELISA Kit
MBS4502872-01 48 Tests

Human Toll Like Receptor Adaptor Molecule 1 (TICAM1) ELISA Kit

Ask
View Details
Human Toll Like Receptor Adaptor Molecule 1 (TICAM1) ELISA Kit
MBS4502872-02 96 Tests

Human Toll Like Receptor Adaptor Molecule 1 (TICAM1) ELISA Kit

Ask
View Details