Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Early Activation Antigen CD69/CD69 (N-8His)

Source: Human Cells. MW :16.9kD. Recombinant Human Early Activation Antigen CD69 is produced by our Mammalian expression system and the target gene encoding Gly64-Lys199 is expressed with a 8His tag at the N-terminus. Human Early Activation Antigen CD69 (CD69) is a type 2 transmembrane glycoprotein in the C-type lectin family. It plays roles in immune cell trafficking, inflammation, T cell memory, and humoral immune responses. CD69 is expressed on the cell surface as an approximately 60 kDa disulfide-linked homodimer. It is found on CD4+ T cells, CD8+ T cells, NK cells, NKT cells, gamma delta cells dendritic cells (DC) and is up-regulated on activated T cells and DC. Ligation of CD69 on DC induces IL2 production, leading to T cell proliferation. CD69 is important for the homing of CD4+ T cells and plasmablasts to the bone marrow but inhibits the migration of dermal DC to draining lymph nodes. It supports the expression of multiple chemokines and chemokine receptors but suppresses the expression of others. It associates with and negatively regulates S1P1 expression on DC and CD4+ T cells, resulting in a decreased chemotactic response to S1P. The direct interaction of CD69 with Galectin-1 contributes to the ability of CD69 to limit Th17 mediated inflamamtion while supporting the differentiation of regulatory T cells.

Product Specifications

Gene Name

CD69

Gene ID

969

UniProt

Q07108

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

HHHHHHHHGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SP1 (NM_138473) Human Untagged Clone
SC101137 10 µg

SP1 (NM_138473) Human Untagged Clone

Ask
View Details
RAB11FIP1 CRISPR All-in-one AAV vector set (with saCas9)(Human)
38292151 3x 1.0 µg DNA

RAB11FIP1 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Ask
View Details
OR51B6 Antibody
A53013-50UG 50 µg

OR51B6 Antibody

Ask
View Details
CJun (pS63) Antibody
abx031853-01 80 µL

CJun (pS63) Antibody

Ask
View Details
CJun (pS63) Antibody
abx031853-02 400 µL

CJun (pS63) Antibody

Ask
View Details
Poly (styrenesulfonic acid), sodium salt [MW ~ 450,000]
26252-250 250 mg

Poly (styrenesulfonic acid), sodium salt [MW ~ 450,000]

Ask
View Details