Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human TRAIL R4/TNFRSF10D/CD264 (C-Fc)

Source: Human Cells. MW :43.4kD. Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 10D is produced by our Mammalian expression system and the target gene encoding Ala56-His211 is expressed with a Fc tag at the C-terminus. Human TRAIL R4 is a type 1, TNF R family membrane protein, which is a receptor for TRAIL (APO2 ligand) . TRAIL R4 contains an extracellular TRAIL-binding domain, a transmembrane domain, and a truncated cytoplasmic death domain. In the new TNF superfamily nomenclature, TRAIL R4 is referred to as TNFRSF10D. TRAIL R4 is unique among the TRAIL receptors in that its cytoplasmic domain contains a truncated consensus death domain motif. Binding of TRAIL R4 does not result in an apoptotic signal. Overexpression of TRAIL R4 can protect cells bearing TRAIL R1 and/or TRAIL R2 from TRAIL mediated apoptosis. The human soluble TRAIL R4/Fc chimera neutralizes the ability of TRAIL to induce apoptosis.

Product Specifications

Gene Name

TNFRSF10D

Gene ID

8793

UniProt

Q9UBN6

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

ATIPRQDEVPQQTVAPQQQRRSLKEEECPAGSHRSEYTGACNPCTEGVDYTIASNNLPSCLLCTVCKSGQTNKSSCTTTRDTVCQCEKGSFQDKNSPEMCRTCRTGCPRGMVKVSNCTPRSDIKCKNESAASSTGKTPAAEETVTTILGMLASPYHIEGRIDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Camel Complement Component 1, Q Subcomponent Like Protein 1 ELISA Kit
MBS088519-01 48 Well

Camel Complement Component 1, Q Subcomponent Like Protein 1 ELISA Kit

Ask
View Details
Camel Complement Component 1, Q Subcomponent Like Protein 1 ELISA Kit
MBS088519-02 96 Well

Camel Complement Component 1, Q Subcomponent Like Protein 1 ELISA Kit

Ask
View Details
Camel Complement Component 1, Q Subcomponent Like Protein 1 ELISA Kit
MBS088519-03 5x 96 Well

Camel Complement Component 1, Q Subcomponent Like Protein 1 ELISA Kit

Ask
View Details
Camel Complement Component 1, Q Subcomponent Like Protein 1 ELISA Kit
MBS088519-04 10x 96 Well

Camel Complement Component 1, Q Subcomponent Like Protein 1 ELISA Kit

Ask
View Details
Catalase (CAT) (NM_001752) Human Recombinant Protein
TP720852XL 1 mg

Catalase (CAT) (NM_001752) Human Recombinant Protein

Ask
View Details
CCR5 (HRP)
557771-01 50 µg

CCR5 (HRP)

Ask
View Details