Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human TRAIL R4/TNFRSF10D/CD264 (C-Fc)

Source: Human Cells. MW :43.4kD. Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 10D is produced by our Mammalian expression system and the target gene encoding Ala56-His211 is expressed with a Fc tag at the C-terminus. Human TRAIL R4 is a type 1, TNF R family membrane protein, which is a receptor for TRAIL (APO2 ligand) . TRAIL R4 contains an extracellular TRAIL-binding domain, a transmembrane domain, and a truncated cytoplasmic death domain. In the new TNF superfamily nomenclature, TRAIL R4 is referred to as TNFRSF10D. TRAIL R4 is unique among the TRAIL receptors in that its cytoplasmic domain contains a truncated consensus death domain motif. Binding of TRAIL R4 does not result in an apoptotic signal. Overexpression of TRAIL R4 can protect cells bearing TRAIL R1 and/or TRAIL R2 from TRAIL mediated apoptosis. The human soluble TRAIL R4/Fc chimera neutralizes the ability of TRAIL to induce apoptosis.

Product Specifications

Gene Name

TNFRSF10D

Gene ID

8793

UniProt

Q9UBN6

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

ATIPRQDEVPQQTVAPQQQRRSLKEEECPAGSHRSEYTGACNPCTEGVDYTIASNNLPSCLLCTVCKSGQTNKSSCTTTRDTVCQCEKGSFQDKNSPEMCRTCRTGCPRGMVKVSNCTPRSDIKCKNESAASSTGKTPAAEETVTTILGMLASPYHIEGRIDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Trim9 siRNA Oligos set (Mouse)
47850174 3x 5 nmol

Trim9 siRNA Oligos set (Mouse)

Ask
View Details
Tris, Tween, MgCl2 Buffer
IBS-BT025 250 mL

Tris, Tween, MgCl2 Buffer

Ask
View Details
Purified anti-STAT3
GT19331 25 µg

Purified anti-STAT3

Ask
View Details
FKBP14 Rabbit Polyclonal Antibody (N-term)
E28PB2405 100 µL

FKBP14 Rabbit Polyclonal Antibody (N-term)

Ask
View Details
SIRP, gamma (Signal Regulatory Protein gamma, SIRPG, CD172 gamma, CD172g, CD172g Antigen, Signal Regulatory Protein beta 2, SIRP beta 2, SIRPbeta2, SIRP-beta-2, SIRP B2, SIRPB2, SIRP-B2) (HRP)
S1013-87KA-HRP 100 µL

SIRP, gamma (Signal Regulatory Protein gamma, SIRPG, CD172 gamma, CD172g, CD172g Antigen, Signal Regulatory Protein beta 2, SIRP beta 2, SIRPbeta2, SIRP-beta-2, SIRP B2, SIRPB2, SIRP-B2) (HRP)

Ask
View Details
Anti-Collagen 2 alpha 1 Antibody
CPA9681-01 30 µL

Anti-Collagen 2 alpha 1 Antibody

Ask
View Details