Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Uteroglobin/SCGB1A1 (C-6His)

Source: Human Cells. MW :9.2kD. Recombinant Mouse Uteroglobin is produced by our Mammalian expression system and the target gene encoding Asp22-Phe96 is expressed with a 6His tag at the C-terminus. Uteroglobin (UG, SCGB1A1) is the founding member of the secretoglobin family of small, secreted, disulfide-bridged dimeric proteins found only in mammals. This protein is mainly expressed in lung, with anti-inflammatory/immunomodulatory properties. CCAAT/enhancer-binding proteins (C/EBPs) are the major transcription factors for the regulation of SCGB1A1 gene expression, whereas FOXA1 had a minimum effect on the transcription. Uteroglobin is a multifunctional protein with anti-inflammatory/immunomodulatory properties. Uteroglobin inhibits soluble phospholipase A (2) activity and binds and perhaps sequesters hydrophobic ligands such as progesterone, retinols, polychlorinated biphenyls, phospholipids, and prostaglandins. In addition to its anti-inflammatory activities, Uteroglobin manifests antichemotactic, antiallergic, antitumorigenic, and embryonic growth-stimulatory activities. Uteroglobin is a potential drug target. The mechanism of Uteroglobin action is likely to be even more complex as it also functions via a putative receptor-mediated pathway.

Product Specifications

Gene Name

Scgb1a1

Gene ID

22287

UniProt

Q06318

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

DICPGFLQVLEALLMESESGYVASLKPFNPGSDLQNAGTQLKRLVDTLPQETRINIMKLTEKILTSPLCKQDLRFHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Growth Hormone Releasing Factor (1-40) (human) (GHRF, GHRH)
G9000-21D 1 mg

Growth Hormone Releasing Factor (1-40) (human) (GHRF, GHRH)

Ask
View Details
MYO1B Recombinant Antibody, PE-Cy5 Conjugated
bsm-62726R-PE-Cy5 100 µL

MYO1B Recombinant Antibody, PE-Cy5 Conjugated

Ask
View Details
Wap Protein Vector (Mouse) (pPM-C-HA)
50249024 500 ng

Wap Protein Vector (Mouse) (pPM-C-HA)

Ask
View Details
TRX discontinued
515365 100 µg

TRX discontinued

Ask
View Details
DAZAP1 Over-expression Lysate Product
GWB-B96F72 0.1 mg

DAZAP1 Over-expression Lysate Product

Ask
View Details