Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cytotoxic T-lymphocyte Protein 4 (C-Fc-Avi)

Source: Human Cells. MW :41.5kD. Recombinant Human Cytotoxic T-lymphocyte Protein 4 is produced by our Mammalian expression system and the target gene encoding Lys36-Asp161 is expressed with a Fc & Avi tag at the C-terminus. Cytotoxic T-lymphocyte protein 4, is a single-pass type I membrane protein. It is widely expressed with highest levels in lymphoid tissues. CD28 and CTLA-4, together with their ligands, B7-1 and B7-2, constitute one of the dominant costimulatory pathways that regulate T and B cell responses. CD28 and CTLA-4 are structurally homologous molecules that are members of the immunoglobulin (Ig) gene superfamily. CTLA4 transmits an inhibitory signal to T cells, whereas CD28 transmits a stimulatory signal. Intracellular CTLA4 is also found in regulatory T Cells and may play an important role in their functions. Tcell activation through the Tcell receptor and CD28 leads to increased expression of CTLA4.

Product Specifications

Gene Name

CTLA4

Gene ID

1493

UniProt

P16410

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

KAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDQEPKSSDKTHTSPPSPAPELLGGSSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGLNDIFEAQKIEWHE
More Discoveries

Explore Other Products

Browse additional items from our catalog

NANOGP6 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV771642 1.0 µg DNA

NANOGP6 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
ACMSD Blocking Peptide
MBS9633757-01 1 mg

ACMSD Blocking Peptide

Sign In for Pricing
View Details
ACMSD Blocking Peptide
MBS9633757-02 5x 1 mg

ACMSD Blocking Peptide

Sign In for Pricing
View Details
Chicken Small nuclear ribonucleoprotein (snRNP/Sm) ELISA Kit
NSL0242Ch 96 Tests

Chicken Small nuclear ribonucleoprotein (snRNP/Sm) ELISA Kit

Sign In for Pricing
View Details
PAI1 Antibody
E38QA5858 100 µL

PAI1 Antibody

Sign In for Pricing
View Details
Slc38a7 3'UTR GFP Stable Cell Line
TU270646 1.0 mL

Slc38a7 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details