Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cytotoxic T-lymphocyte Protein 4 (C-Fc-Avi)

Source: Human Cells. MW :41.5kD. Recombinant Human Cytotoxic T-lymphocyte Protein 4 is produced by our Mammalian expression system and the target gene encoding Lys36-Asp161 is expressed with a Fc & Avi tag at the C-terminus. Cytotoxic T-lymphocyte protein 4, is a single-pass type I membrane protein. It is widely expressed with highest levels in lymphoid tissues. CD28 and CTLA-4, together with their ligands, B7-1 and B7-2, constitute one of the dominant costimulatory pathways that regulate T and B cell responses. CD28 and CTLA-4 are structurally homologous molecules that are members of the immunoglobulin (Ig) gene superfamily. CTLA4 transmits an inhibitory signal to T cells, whereas CD28 transmits a stimulatory signal. Intracellular CTLA4 is also found in regulatory T Cells and may play an important role in their functions. Tcell activation through the Tcell receptor and CD28 leads to increased expression of CTLA4.

Product Specifications

Gene Name

CTLA4

Gene ID

1493

UniProt

P16410

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

KAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDQEPKSSDKTHTSPPSPAPELLGGSSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGLNDIFEAQKIEWHE
More Discoveries

Explore Other Products

Browse additional items from our catalog

Serotonin (5-HT)
X1819P Inquire

Serotonin (5-HT)

Sign In for Pricing
View Details
Rabbit Monoclonal Complement Factor H-related 2/CFHR2/CFHL2 Antibody (005) [Alexa Fluor 594]
NBP2-90262AF594 0.1 mL

Rabbit Monoclonal Complement Factor H-related 2/CFHR2/CFHL2 Antibody (005) [Alexa Fluor 594]

Sign In for Pricing
View Details
CD11a (Leukocyte Function Associated Antigen, LFA-1, Integrin aL) (FITC) discontinued
C2262-03J-FITC 100 µL

CD11a (Leukocyte Function Associated Antigen, LFA-1, Integrin aL) (FITC) discontinued

Sign In for Pricing
View Details
turboGFP, AlpHcAbs® Rabbit antibody (Biotin)
HA710091 100 µg

turboGFP, AlpHcAbs® Rabbit antibody (Biotin)

Sign In for Pricing
View Details
TLR11 Blocking Peptide
NBP1-77202PEP 0.05 mg

TLR11 Blocking Peptide

Sign In for Pricing
View Details
HtrA3 (Serine Protease HTRA3, 3421-, High-temperature requirement Factor A3, Pregnancy-Related Serine Protease, HTRA3, PRSP) (HRP) discontinued
302494-HRP 200 µL

HtrA3 (Serine Protease HTRA3, 3421-, High-temperature requirement Factor A3, Pregnancy-Related Serine Protease, HTRA3, PRSP) (HRP) discontinued

Sign In for Pricing
View Details