Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Signal Transducer CD24/CD24 (C-Fc)

Source: Human Cells. MW :29.8kD. Recombinant Human Signal Transducer CD24 is produced by our Mammalian expression system and the target gene encoding Ser27-Gly59 is expressed with a Fc tag at the C-terminus. Signal Transducer CD24 is a heavily and variably glycosylated GPI-linked sialoprotein. Human CD24 is expressed on B lineage cells and granulocytes, on epithelial, neuronal, and muscle cells, and on a range of tumor cells. CD24 expression is regulated during lineage development and with the activation of various cell types. Antibody crosslinking of CD24 enhances the induction of apoptosis in B and T lymphocytes which contributes to negative selection and the induction of immune tolerance. CD24 on antigen presenting cells cooperates with B7 molecules in the costimulation of T cells. CD24 associates in cis with Siglec10 and with the danger-associated molecules HMGB1, HSP70, or HSP90 which are released from necrotic or damaged cells. Formation of these ternary complexes fills a protective role: the resulting Siglec10 signaling inhibits inflammatory responses that are otherwise induced by extracellular DAMPs.

Product Specifications

Gene Name

CD24

Gene ID

100133941

UniProt

P25063

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

SETTTGTSSNSSQSTSNTGLAPNPTNATTKAAGIEGRMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CREB, phosphorylated (Ser133) (cAMP Response Element Binding Protein) (HRP) discontinued
C7915-07-HRP 100 µL

CREB, phosphorylated (Ser133) (cAMP Response Element Binding Protein) (HRP) discontinued

Ask
View Details
Rabbit Monoclonal ABHD14B Antibody (002) [Biotin]
NBP2-90259B 0.1 mL

Rabbit Monoclonal ABHD14B Antibody (002) [Biotin]

Ask
View Details
Gria2 (NM_001039195) Mouse Tagged Lenti ORF Clone
MR227068L3 10 µg

Gria2 (NM_001039195) Mouse Tagged Lenti ORF Clone

Ask
View Details
GTF2H1 (General Transcription Factor IIH, Polypeptide 1, 62kD, BTF2, TFB1, TFIIH) (AP)
MBS6161603-01 0.1 mL

GTF2H1 (General Transcription Factor IIH, Polypeptide 1, 62kD, BTF2, TFB1, TFIIH) (AP)

Ask
View Details
GTF2H1 (General Transcription Factor IIH, Polypeptide 1, 62kD, BTF2, TFB1, TFIIH) (AP)
MBS6161603-02 5x 0.1 mL

GTF2H1 (General Transcription Factor IIH, Polypeptide 1, 62kD, BTF2, TFB1, TFIIH) (AP)

Ask
View Details
Polyclonal Antibody to Procollagen I N-Terminal Propeptide (PINP)
MBS2004656-01 0.1 mL

Polyclonal Antibody to Procollagen I N-Terminal Propeptide (PINP)

Ask
View Details