Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Signal Transducer CD24/CD24 (C-Fc)

Source: Human Cells. MW :29.8kD. Recombinant Human Signal Transducer CD24 is produced by our Mammalian expression system and the target gene encoding Ser27-Gly59 is expressed with a Fc tag at the C-terminus. Signal Transducer CD24 is a heavily and variably glycosylated GPI-linked sialoprotein. Human CD24 is expressed on B lineage cells and granulocytes, on epithelial, neuronal, and muscle cells, and on a range of tumor cells. CD24 expression is regulated during lineage development and with the activation of various cell types. Antibody crosslinking of CD24 enhances the induction of apoptosis in B and T lymphocytes which contributes to negative selection and the induction of immune tolerance. CD24 on antigen presenting cells cooperates with B7 molecules in the costimulation of T cells. CD24 associates in cis with Siglec10 and with the danger-associated molecules HMGB1, HSP70, or HSP90 which are released from necrotic or damaged cells. Formation of these ternary complexes fills a protective role: the resulting Siglec10 signaling inhibits inflammatory responses that are otherwise induced by extracellular DAMPs.

Product Specifications

Gene Name

CD24

Gene ID

100133941

UniProt

P25063

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

SETTTGTSSNSSQSTSNTGLAPNPTNATTKAAGIEGRMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Orc3 Mouse shRNA Lentiviral Particle (Locus ID 50793)
TL516082V 500 µL Each

Orc3 Mouse shRNA Lentiviral Particle (Locus ID 50793)

Ask
View Details
EIF2AK2, CT (Eukaryotic Translation Initiation Factor 2-alpha Kinase 2, eIF-2A Protein Kinase 2, Interferon-induced, Double-stranded RNA-activated Protein Kinase, Interferon-inducible RNA-dependent pRotein Kinase, p68 kinase, Protein Kinase RNA-activated, PKR, P1/eIF-2A Protein Kinase, PRKR) (MaxLight 650) discontinued
E8949-16A-ML650 100 µL

EIF2AK2, CT (Eukaryotic Translation Initiation Factor 2-alpha Kinase 2, eIF-2A Protein Kinase 2, Interferon-induced, Double-stranded RNA-activated Protein Kinase, Interferon-inducible RNA-dependent pRotein Kinase, p68 kinase, Protein Kinase RNA-activated, PKR, P1/eIF-2A Protein Kinase, PRKR) (MaxLight 650) discontinued

Ask
View Details
Goose Motilin Receptor (MLNR) ELISA Kit
MBS9911387 Inquire

Goose Motilin Receptor (MLNR) ELISA Kit

Ask
View Details
PRIM1 Adenovirus (Human)
37616051 1.0 mL

PRIM1 Adenovirus (Human)

Ask
View Details
Bovine Phosphodiesterase ELISA Kit
MBS008992-01 48 Well

Bovine Phosphodiesterase ELISA Kit

Ask
View Details
Bovine Phosphodiesterase ELISA Kit
MBS008992-02 96 Well

Bovine Phosphodiesterase ELISA Kit

Ask
View Details