Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse LILRB4/CD85k/ILT3 (C-6His)

Source: Human Cells. MW :24.9kD. Recombinant Mouse Leukocyte Immunoglobulin-like Receptor Subfamily B Member 4 is produced by our Mammalian expression system and the target gene encoding Gly24-Lys238 is expressed with a 6His tag at the C-terminus. Mouse Leukocyte Immunoglobulin-like Receptor Subfamily B Member 4 (LILRB4/CD85k/ILT3) is an approximately transmembrane glycoprotein that negatively regulates immune cell activation. Mouse LILRB4 consists of a 215 amino acid (aa) extracellular domain with two Ig-like domains, a 22 aa transmembrane segment, and a 75 aa cytoplasmic domain with 3 immunoreceptor tyrosine-based inhibitory motifs (ITIM) . Within the ECD, mouse LILRB4 shares 45% and 77% aa sequence identity with human and rat LILRB4, respectively. Alternative splicing of mouse LILRB4 generates a potentially soluble isoform that lacks the transmembrane segment. LILRB4 is expressed on dendritic cells (DC), monocytes, macrophages, and vascular endothelial cells (EC) . Ligation of LILRB4 triggers ITIM-mediated inhibition of cellactivating signaling, leading to enhanced immune tolerance and reduced allogeneic graft rejection. Soluble LILRB4 induces the differentiation of CD8+ T suppressor cells (Ts) that can inhibit the effector functions of CD4+ Th cells and CD8+ CTL. In turn, CD8+ Ts cells induce LILRB4 up-regulation and a tolerogenic phenotype in monocytes, DC, and EC.

Product Specifications

Gene Name

Lilrb4

Gene ID

14728

UniProt

Q64281

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GHLPKPIIWAEPGSVIAAYTSVITWCQGSWEAQYYHLYKEKSVNPWDTQVPLETRNKAKFNIPSMTTSYAGIYKCYYESAAGFSEHSDAMELVMTGAYENPSLSVYPSSNVTSGVSISFSCSSSIVFGRFILIQEGKHGLSWTLDSQHQANQPSYATFVLDAVTPNHNGTFRCYGYFRNEPQVWSKPSNSLDLMISETKDQSSTPTEDGLETYQKHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

DR4 MEF Cell Line
RWT-843 1x 10^6

DR4 MEF Cell Line

Ask
View Details
Glutamate, Vesicular Transporters 1, NT (VGLUT1, BNPI) (Not for Export EU)
G4005-61D 100 µL

Glutamate, Vesicular Transporters 1, NT (VGLUT1, BNPI) (Not for Export EU)

Ask
View Details
1,4-Bis (3- (2- (trifluoromethyl) -10H-phenothiazin-10-yl) propyl) piperazine-d8
411250-01 1 mg

1,4-Bis (3- (2- (trifluoromethyl) -10H-phenothiazin-10-yl) propyl) piperazine-d8

Ask
View Details
1,4-Bis (3- (2- (trifluoromethyl) -10H-phenothiazin-10-yl) propyl) piperazine-d8
411250-02 5 mg

1,4-Bis (3- (2- (trifluoromethyl) -10H-phenothiazin-10-yl) propyl) piperazine-d8

Ask
View Details
EAAT3 (SLC1A1) (NM_004170) Human Over-expression Lysate
E45H19048-2 20 µg

EAAT3 (SLC1A1) (NM_004170) Human Over-expression Lysate

Ask
View Details
Lysis Buffer
E-IR-IP004-01 50 mL

Lysis Buffer

Ask
View Details