Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CD226 Antigen/DNAM-1/CD226 (C-Fc)

Source: Human Cells. MW :52.8kD. Recombinant Human CD226 Antigen is produced by our Mammalian expression system and the target gene encoding Glu19-Asn247 is expressed with a Fc tag at the C-terminus. Human DNAX accessory molecule 1 (DNAM-1/CD226) is a 65 kDa type I transmembrane glycoprotein in the immunoglobulin superfamily. Mature human DNAM-1 contains an extracellular domain (ECD) with two Ig-like C2-set domains and a cytoplasmic region that contains motifs for binding PDZ domains and band 4.1 family proteins. DNAM-1 is expressed on multiple lymphoid and myeloid cells and interacts with CD155 and CD112. Ligation of DNAM-1 promotes the activation of NK cells, CD8+ T cells, and mast cells, dendritic cell maturation, megakaryocyte and activated platelet adhesion to vascular endothelial cells, and monocyte extravasation; it inhibits the forrmation of osteoclasts. Plateletendothelium, interactions mediated by DNAM-1, enable the metastasis of tumor cells to the lung.

Product Specifications

Gene Name

CD226

Gene ID

10666

UniProt

Q15762

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

EEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDNHIEGRMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Geobacillus kaustophilus UPF0356 protein GK1054 (GK1054)
MBS1322905-01 0.02 mg (E-Coli)

Recombinant Geobacillus kaustophilus UPF0356 protein GK1054 (GK1054)

Ask
View Details
Recombinant Geobacillus kaustophilus UPF0356 protein GK1054 (GK1054)
MBS1322905-02 0.1 mg (E-Coli)

Recombinant Geobacillus kaustophilus UPF0356 protein GK1054 (GK1054)

Ask
View Details
Recombinant Geobacillus kaustophilus UPF0356 protein GK1054 (GK1054)
MBS1322905-03 0.02 mg (Yeast)

Recombinant Geobacillus kaustophilus UPF0356 protein GK1054 (GK1054)

Ask
View Details
Recombinant Geobacillus kaustophilus UPF0356 protein GK1054 (GK1054)
MBS1322905-04 0.1 mg (Yeast)

Recombinant Geobacillus kaustophilus UPF0356 protein GK1054 (GK1054)

Ask
View Details
Recombinant Geobacillus kaustophilus UPF0356 protein GK1054 (GK1054)
MBS1322905-05 0.02 mg (Baculovirus)

Recombinant Geobacillus kaustophilus UPF0356 protein GK1054 (GK1054)

Ask
View Details
Recombinant Geobacillus kaustophilus UPF0356 protein GK1054 (GK1054)
MBS1322905-06 1 mg (E-Coli)

Recombinant Geobacillus kaustophilus UPF0356 protein GK1054 (GK1054)

Ask
View Details