Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Renin (C-10His)

Source: Human Cells. MW :43.5kD. Recombinant Mouse Renin is produced by our Mammalian expression system and the target gene encoding Leu22-Arg402 is expressed with a 10His tag at the C-terminus. Mouse Renin, also known as Renin-1, is a member of the peptidase A1 amily. Renin is synthesized by the juxtaglomerular cells of the kidney in response to decreased blood pressure and sodium concentration. It cleaves angiotensinogen to generate angiotensin I, which can be further converted by angiotensin converting enzyme (ACE) to angiotensin II. Angiotensin II is the active molecule of the reninangiotensin system that acts by binding to angiotensin receptors type 1 and 2 (AT1 and AT2), and has direct pathophysiological effects on the heart and peripheral vasculature. After secretion, inactive prorenin can be proteolytically activated by trypsin, cathepsin B, or other proteinases.

Product Specifications

Gene Name

Ren1

Gene ID

19701

UniProt

P06281

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

LPTRTATFERIPLKKMPSVREILEERGVDMTRLSAEWGVFTKRPSLTNLTSPVVLTNYLNTQYYGEIGIGTPPQTFKVIFDTGSANLWVPSTKCSRLYLACGIHSLYESSDSSSYMENGSDFTIHYGSGRVKGFLSQDSVTVGGITVTQTFGEVTELPLIPFMLAKFDGVLGMGFPAQAVGGVTPVFDHILSQGVLKEEVFSVYYNRGSHLLGGEVVLGGSDPQHYQGNFHYVSISKTDSWQITMKGVSVGSSTLLCEEGCAVVVDTGSSFISAPTSSLKLIMQALGAKEKRIEEYVVNCSQVPTLPDISFDLGGRAYTLSSTDYVLQYPNRRDKLCTLALHAMDIPPPTGPVWVLGATFIRKFYTEFDRHNNRIGFALARGGGGSHHHHHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Coiled-Coil Domain Containing 8 (CCDC8) Antibody
abx375516 100 µg

Coiled-Coil Domain Containing 8 (CCDC8) Antibody

Ask
View Details
Human GSTM2/Glutathione S-transferase Mu 2 ELISA Kit
MBS2903821-01 48 Well

Human GSTM2/Glutathione S-transferase Mu 2 ELISA Kit

Ask
View Details
Human GSTM2/Glutathione S-transferase Mu 2 ELISA Kit
MBS2903821-02 96 Well

Human GSTM2/Glutathione S-transferase Mu 2 ELISA Kit

Ask
View Details
Human GSTM2/Glutathione S-transferase Mu 2 ELISA Kit
MBS2903821-03 5x 96 Well

Human GSTM2/Glutathione S-transferase Mu 2 ELISA Kit

Ask
View Details
Human GSTM2/Glutathione S-transferase Mu 2 ELISA Kit
MBS2903821-04 10x 96 Well

Human GSTM2/Glutathione S-transferase Mu 2 ELISA Kit

Ask
View Details
Canine Serine/Threonine-Protein Kinase GSK3A (GSK3A)
MBS013530-01 48 Well

Canine Serine/Threonine-Protein Kinase GSK3A (GSK3A)

Ask
View Details