Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Renin (C-10His)

Source: Human Cells. MW :43.5kD. Recombinant Mouse Renin is produced by our Mammalian expression system and the target gene encoding Leu22-Arg402 is expressed with a 10His tag at the C-terminus. Mouse Renin, also known as Renin-1, is a member of the peptidase A1 amily. Renin is synthesized by the juxtaglomerular cells of the kidney in response to decreased blood pressure and sodium concentration. It cleaves angiotensinogen to generate angiotensin I, which can be further converted by angiotensin converting enzyme (ACE) to angiotensin II. Angiotensin II is the active molecule of the reninangiotensin system that acts by binding to angiotensin receptors type 1 and 2 (AT1 and AT2), and has direct pathophysiological effects on the heart and peripheral vasculature. After secretion, inactive prorenin can be proteolytically activated by trypsin, cathepsin B, or other proteinases.

Product Specifications

Gene Name

Ren1

Gene ID

19701

UniProt

P06281

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

LPTRTATFERIPLKKMPSVREILEERGVDMTRLSAEWGVFTKRPSLTNLTSPVVLTNYLNTQYYGEIGIGTPPQTFKVIFDTGSANLWVPSTKCSRLYLACGIHSLYESSDSSSYMENGSDFTIHYGSGRVKGFLSQDSVTVGGITVTQTFGEVTELPLIPFMLAKFDGVLGMGFPAQAVGGVTPVFDHILSQGVLKEEVFSVYYNRGSHLLGGEVVLGGSDPQHYQGNFHYVSISKTDSWQITMKGVSVGSSTLLCEEGCAVVVDTGSSFISAPTSSLKLIMQALGAKEKRIEEYVVNCSQVPTLPDISFDLGGRAYTLSSTDYVLQYPNRRDKLCTLALHAMDIPPPTGPVWVLGATFIRKFYTEFDRHNNRIGFALARGGGGSHHHHHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM42 Antibody
E309222 200 µL

TRIM42 Antibody

Sign In for Pricing
View Details
WNT10A Antibody
orb1558366-01 50 μL

WNT10A Antibody

Sign In for Pricing
View Details
WNT10A Antibody
orb1558366-02 100 µL

WNT10A Antibody

Sign In for Pricing
View Details
WNT10A Antibody
orb1558366-03 200 µL

WNT10A Antibody

Sign In for Pricing
View Details
M6C-1500-584-OR Continuous Tapes for Printers
176819 1 Box (1 Roll x 1 Roll)

M6C-1500-584-OR Continuous Tapes for Printers

Sign In for Pricing
View Details
EDG1, NT (Endothelial Differentiation, Sphingolipid G-protein-coupled Receptor, 1, Isoform CRA_a, hCG_1640193)
E2208-01B 200 µL

EDG1, NT (Endothelial Differentiation, Sphingolipid G-protein-coupled Receptor, 1, Isoform CRA_a, hCG_1640193)

Sign In for Pricing
View Details