Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Renin (C-10His)

Source: Human Cells. MW :44kD. Recombinant Human Renin is produced by our Mammalian expression system and the target gene encoding Leu24-Arg406 is expressed with a 10His tag at the C-terminus. Renin is a member of the aspartyl proteinase family produced largely in part by the juxtaglomerular cells in the kidney. Renin is produced as prorenin with 43 pro residues at the N-terminal of mature Renin. The inactive prorenin becomes activated proteolytically by trypsin, cathepsin B, or other proteinases. Renin also has a very high selectivity for substrates due to a long peptide recognition on either side of the peptide bond undergoing cleavage. An octapeptide substrate was the minimum length to be cleaved by Renin. Renin plays a crucial role in the regulation of blood pressure and salt balance through the cleavage of angiotensinogen, which is the only known physiological substrate of Renin. Renin releases the decapeptide angiotensin I, which in turn is further converted to vasoactive hormone angiotensin II by angiotensin converting enzyme (ACE) .

Product Specifications

Gene Name

REN

Gene ID

5972

UniProt

P00797

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

LPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEWSQPMKRLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALARGGGGSHHHHHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Ergosterol Impurity 5
RM-D272005-01 10 mg

Ergosterol Impurity 5

Ask
View Details
Ergosterol Impurity 5
RM-D272005-02 25 mg

Ergosterol Impurity 5

Ask
View Details
Ergosterol Impurity 5
RM-D272005-03 50 mg

Ergosterol Impurity 5

Ask
View Details
Ergosterol Impurity 5
RM-D272005-04 100 mg

Ergosterol Impurity 5

Ask
View Details
Rabbit Polyclonal FAR2 Antibody [Janelia Fluor 549]
NBP2-97541JF549 0.1 mL

Rabbit Polyclonal FAR2 Antibody [Janelia Fluor 549]

Ask
View Details
TLR3 (Toll Like Receptor 3, Toll-like Receptor 3, TLR 3, TLR-3, CD283, CD283 Antigen) discontinued, see T8050-24
T8050-20P 100 µg

TLR3 (Toll Like Receptor 3, Toll-like Receptor 3, TLR 3, TLR-3, CD283, CD283 Antigen) discontinued, see T8050-24

Ask
View Details