Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Renin (C-10His)

Source: Human Cells. MW :44kD. Recombinant Human Renin is produced by our Mammalian expression system and the target gene encoding Leu24-Arg406 is expressed with a 10His tag at the C-terminus. Renin is a member of the aspartyl proteinase family produced largely in part by the juxtaglomerular cells in the kidney. Renin is produced as prorenin with 43 pro residues at the N-terminal of mature Renin. The inactive prorenin becomes activated proteolytically by trypsin, cathepsin B, or other proteinases. Renin also has a very high selectivity for substrates due to a long peptide recognition on either side of the peptide bond undergoing cleavage. An octapeptide substrate was the minimum length to be cleaved by Renin. Renin plays a crucial role in the regulation of blood pressure and salt balance through the cleavage of angiotensinogen, which is the only known physiological substrate of Renin. Renin releases the decapeptide angiotensin I, which in turn is further converted to vasoactive hormone angiotensin II by angiotensin converting enzyme (ACE) .

Product Specifications

Gene Name

REN

Gene ID

5972

UniProt

P00797

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

LPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEWSQPMKRLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALARGGGGSHHHHHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

UROD (G-7)
sc-374318 200 µg/mL

UROD (G-7)

Ask
View Details
SLC30A6 Antibody, FITC conjugated
A58259-50UG 50 µg

SLC30A6 Antibody, FITC conjugated

Ask
View Details
Frozen Tissue Sections, Fallopian tube
CS501378 5x 5 µm

Frozen Tissue Sections, Fallopian tube

Ask
View Details
TRK fused gene (TFG) (NM_006070) Human Tagged ORF Clone Lentiviral Particle
RC201093L4V 200 µL

TRK fused gene (TFG) (NM_006070) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
Methyl 5-Methyl-2-[ (1-phenylpyrrolidene) amino]benzoate
M3515-65 100 mg

Methyl 5-Methyl-2-[ (1-phenylpyrrolidene) amino]benzoate

Ask
View Details
AdmiRa-rno-miR-1956-5p Virus
mr0613 250 µL

AdmiRa-rno-miR-1956-5p Virus

Ask
View Details