Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Decorin (C-6His)

Source: Human Cells. MW :38.8kD. Recombinant Human Decorin is produced by our Mammalian expression system and the target gene encoding Gly17-Lys359 is expressed with a 6His tag at the C-terminus. Decorin is a secreted chondroitin/dermatan sulfate proteoglycan in the family of small leucine-rich proteoglycans (SLRPs) . SLRP family members are characterized by N-terminal and C-terminal cysteine-rich regions which flank the central region containing 10-12 tandem leucine-rich repeats (LRR) . The human Decorin cDNA encodes a 359 amino acid (aa) precursor that includes a 16 aa signal sequence and a 14 aa propeptide. Alternate splicing of human Decorin generates five isoforms with variable length deletions. Decorin is an N-glycosylated protein that also carries a variablysized hybrid chondroitin/dermatan sulfate chain at Ser34. Decorin regulates assembly of the extracellular collagen matrix and the bioactivity of the matrix associated growth factors FGF2, GDF8/Myostatin, TGF beta, and WISP1. It also binds and activates EGF R, ErbB4, and IGFI-R. In vivo, Decorin promotes myoblast differentiation, supports angiogenesis, and inhibits tumor progression.

Product Specifications

Gene Name

DCN

Gene ID

1634

UniProt

P07585

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GPFQQRGLFDFMLEDEASGIGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVPKDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKVSPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITSIPQGLPPSLTELHLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNKLTRVPGGLAEHKYIQVVYLHNNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRSAIQLGNYKHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Growth/differentiation factor 15 Polyclonal Antibody
MBS9415551-01 0.1 mg

Growth/differentiation factor 15 Polyclonal Antibody

Ask
View Details
Growth/differentiation factor 15 Polyclonal Antibody
MBS9415551-02 5x 0.1 mg

Growth/differentiation factor 15 Polyclonal Antibody

Ask
View Details
Methyl D-Tyrosinate
455889-01 1 g

Methyl D-Tyrosinate

Ask
View Details
Methyl D-Tyrosinate
455889-02 10 g

Methyl D-Tyrosinate

Ask
View Details
BIM-46187 4HCl
MBS3613775-01 2 mg

BIM-46187 4HCl

Ask
View Details
BIM-46187 4HCl
MBS3613775-02 5 mg

BIM-46187 4HCl

Ask
View Details