Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Interleukin-12/IL-12 (C-6His)

Source: Human Cells. MW :36.7&22.6kD. Recombinant Rat Interleukin-12 is produced by our Mammalian expression system and the target gene encoding Met23-Ser335 (p40) &Arg23-Ser215 (p35) is expressed with a 6His tag at the C-terminus. Interleukin 12 (IL-12) is the founding member of the IL-12 family of heterodimeric cytokines, which have important immunological functions. IL-12 is composed of two disulfide-linkedsubunits of 35 kDa and 40 kDa, respectively. The 35 kDa subunit (p35) is an a-helical protein homologous to IL-6 and GCSF.The 40 kDa subunit (p40) contains one fibronectin type III and one Ig C2-like domain, and has a high degree of structural homology to type I cytokine receptors. Whereas p35 subunit is unique to IL-12, the p40 subunit is also utilized in IL-23.Mature rat p35 is a 194 amino acids (aa) protein that is secreted as a heterodimer linked to p40. It contains three potential N-linked glycosylation sites and shares 86%, and 58% aa sequence identity with mouse and human p35, respectively. Mature rat p40 contains 313 aa and can exist in multiple forms, including monomer, homodimer, heterodimer linked to p19 (forming IL23), and heterodimer linked to p35 (forming IL-12) . IL12 facilitates hematopoietic stem cell proliferation, induces NK cell proliferation, and potentiates the expansion and late activation of Th1 CD4+ T cells.

Product Specifications

Gene Name

Il12b

Gene ID

64546

UniProt

Q9R278

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MWELEKDVYVVEVDWRPDAPGETVTLTCDSPEEDDITWTSDQRRGVIGSGKTLTITVREFLDAGQYTCHRGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVHRNTDLKFNIKSSSSSPESRAVTCGRASLSAEKVTLNQRDYEKYSVACQEDVTCPTAEETLPIELVVEAQQQNKYENYSTSFFIRDIIKPDPPKNLQVKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKTKETEEECNQKGAFLVEKTSAEVQCKGANICVQAQDRYYNSSCSKWTCVPCRGRSHHHHHH&RVIPVSGPAKCLNQSQNLLKTTDDMVRTAREKLKHYSCTAGDIDHEDITRDKTSTLEACLPLELHKNESCLATKETSSIIRGSCLPPQKTSLMMTLCLGSIYEDLKMYQSEFQAINAALQSHNHQQITLDRNMLMAIDELMRSLNHSGETLHQKAPMGEADPYRVKMKLCILLHAFSTRVMTINRVMNYLSSSHHHHHH
More Discoveries

Explore Other Products

Browse additional items from our catalog

NEK1 Antibody
MBS7108427-01 0.05 mg

NEK1 Antibody

Sign In for Pricing
View Details
NEK1 Antibody
MBS7108427-02 0.1 mg

NEK1 Antibody

Sign In for Pricing
View Details
NEK1 Antibody
MBS7108427-03 5x 0.1 mg

NEK1 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal ALS2CR4 Antibody
NBP2-33656 0.1 mL

Rabbit Polyclonal ALS2CR4 Antibody

Sign In for Pricing
View Details
Anti-Fatty acid-binding protein, adipocyte (ALBP) Antibody
C-1527-100 100 µL

Anti-Fatty acid-binding protein, adipocyte (ALBP) Antibody

Sign In for Pricing
View Details
Carcinoembryonic Antigen (CEA, CD66e) (Not for Export EU)
C1299-98 50 µL

Carcinoembryonic Antigen (CEA, CD66e) (Not for Export EU)

Sign In for Pricing
View Details