Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cynomolgus CD3d / CD3 delta Protein (C-6His)

Source: Human Cells. MW :10.4kD. Recombinant Cynomolgus T-cell Surface Glycoprotein CD3 Delta Chain protein is produced by our Mammalian expression system and the target gene encoding Phe22-Ala105 is expressed with a 6His tag at the C-terminus. T-cell surface glycoprotein CD3 delta chain (CD3D) is a single-pass type I membrane protein. CD3D, together with CD3-gamma, CD3-epsilon and CD3-zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T cell receptor-CD3 complex. CD3 chains are present as CD3gammaepsilon, deltaepsilon, and zetazeta dimers in the receptor complex and play critical roles in the antigen receptor assembly, transport to the cell surface, and the receptor-mediated signal transduction. T cell receptor-CD3 complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. This complex is critical for T-cell development and function, and represents one of the most complex transmembrane receptors. The T cell receptor-CD3 complex is unique in having ten cytoplasmic immunoreceptor tyrosine-based activation motifs (ITAMs) . CD3D contains 1 ITAM domain and has been shown to interact with CD8A.

Product Specifications

Gene Name

CD3D

Gene ID

102133701

UniProt

Q95LI8

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

FKIPVEELEDRVFVKCNTSVTWVEGTVGTLLTNNTRLDLGKRILDPRGIYRCNGTDIYKDKESAVQVHYRMCQNCVELDPATLAHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Horse Beta, Beta-Carotene 9',10'-Oxygenase (BCO2) ELISA Kit
MBS9921979-01 48 Well

Horse Beta, Beta-Carotene 9',10'-Oxygenase (BCO2) ELISA Kit

Ask
View Details
Horse Beta, Beta-Carotene 9',10'-Oxygenase (BCO2) ELISA Kit
MBS9921979-02 96 Well

Horse Beta, Beta-Carotene 9',10'-Oxygenase (BCO2) ELISA Kit

Ask
View Details
Horse Beta, Beta-Carotene 9',10'-Oxygenase (BCO2) ELISA Kit
MBS9921979-03 5x 96 Well

Horse Beta, Beta-Carotene 9',10'-Oxygenase (BCO2) ELISA Kit

Ask
View Details
Horse Beta, Beta-Carotene 9',10'-Oxygenase (BCO2) ELISA Kit
MBS9921979-04 10x 96 Well

Horse Beta, Beta-Carotene 9',10'-Oxygenase (BCO2) ELISA Kit

Ask
View Details
Human Caspase 13 (CASP13) ELISA kit
YLA2998HU-01 48 Tests

Human Caspase 13 (CASP13) ELISA kit

Ask
View Details
Human Caspase 13 (CASP13) ELISA kit
YLA2998HU-02 96 Tests

Human Caspase 13 (CASP13) ELISA kit

Ask
View Details