Recombinant Cynomolgus CD3d / CD3 delta Protein (C-6His)
Source: Human Cells. MW :10.4kD. Recombinant Cynomolgus T-cell Surface Glycoprotein CD3 Delta Chain protein is produced by our Mammalian expression system and the target gene encoding Phe22-Ala105 is expressed with a 6His tag at the C-terminus. T-cell surface glycoprotein CD3 delta chain (CD3D) is a single-pass type I membrane protein. CD3D, together with CD3-gamma, CD3-epsilon and CD3-zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T cell receptor-CD3 complex. CD3 chains are present as CD3gammaepsilon, deltaepsilon, and zetazeta dimers in the receptor complex and play critical roles in the antigen receptor assembly, transport to the cell surface, and the receptor-mediated signal transduction. T cell receptor-CD3 complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. This complex is critical for T-cell development and function, and represents one of the most complex transmembrane receptors. The T cell receptor-CD3 complex is unique in having ten cytoplasmic immunoreceptor tyrosine-based activation motifs (ITAMs) . CD3D contains 1 ITAM domain and has been shown to interact with CD8A.
Product Specifications
Gene Name
CD3D
Gene ID
102133701
UniProt
Q95LI8
Components
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
FKIPVEELEDRVFVKCNTSVTWVEGTVGTLLTNNTRLDLGKRILDPRGIYRCNGTDIYKDKESAVQVHYRMCQNCVELDPATLAHHHHHH
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items