Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human NKG2A & CD94 Heterodimer (N-8His & N-Flag)

Source: Human cells. MW :34.4kD. Recombinant Human Human NKG2A & CD94 Heterodimer is produced by our Mammalian expression system and the target gene encoding Arg100-Leu233 & Ser34-Ile179 is expressedwith a 8His & Flag tag at the N-terminus NKG2-A/NKG2-B Type II Integral Membrane Protein contains 1 C-type lectin domain and belongs to the killer cell lectin-like receptor family. The killer cell lectin-like receptor family is a group of transmembrane proteins preferentially expressed in NK cells. Natural killer (NK) cells are a distinct lineage of lymphocytes that mediate cytotoxic activity and secrete cytokines upon immune stimulation. CD94 (Cluster of Differentiation 94), also known as killer cell lectin-like receptor subfamily D member 1 (KLRD1), is expressed on the surface of natural killer cells in the innate immune system. CD94 Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells. CD94 Can form disulfide-bonded heterodimer with NKG2 family members. The CD94/NKG2 complex, on the surface of natural killer cells interacts with Human Leukocyte Antigen (HLA) -E on target cells.

Product Specifications

Gene Name

KLRC1

Gene ID

3821

UniProt

P26715

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

HHHHHHHHRHNNSSLNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLSIISPSSWIGVFRNSSHHPWVTMNGLAFKHEIKDSDNAELNCAVLQVNRLKSAQCGSSIIYHCKHKL&DYKDDDDKSFTKLSIEPAFTPGPNIELQKDSDCCSCQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSQQFYWIGLSYSEEHTAWLWENGSALSQYLFPSFETFNTKNCIAYNPNGNALDESCEDKNRYICKQQLI
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TRNAP21 CRISPRa sgRNA lentivector (set of three targets)(Human)
48263121 3x 1.0µg DNA

TRNAP21 CRISPRa sgRNA lentivector (set of three targets)(Human)

Ask
View Details
SELV, CT (SELV, Selenoprotein V) (APC)
MBS6345955-01 0.2 mL

SELV, CT (SELV, Selenoprotein V) (APC)

Ask
View Details
SELV, CT (SELV, Selenoprotein V) (APC)
MBS6345955-02 5x 0.2 mL

SELV, CT (SELV, Selenoprotein V) (APC)

Ask
View Details
FAD Assay
MA-0271 100 Well

FAD Assay

Ask
View Details
Lentiviral human GLDC shRNA (UAS) - Lentiviral human GLDC shRNA (UAS, RFP) plasmid
GTR15122137 1 Vial

Lentiviral human GLDC shRNA (UAS) - Lentiviral human GLDC shRNA (UAS, RFP) plasmid

Ask
View Details