Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Left-right Determination Factor 2/Lefty-A (N-6His)

Source: Human Cells. MW :39.1kD. Recombinant Human Left-right Determination Factor 2 is produced by our Mammalian expression system and the target gene encoding Phe78-Pro366 is expressed fused with a Mouse Lefty-1 Propeptide (Leu22-Arg77) & 6His tag at the N-terminus. Left-right determination factor 2 (LEFTY2) is a secreted protein which belongs to the TGF-beta family. Lefty was first identified in a screen for undifferentiated cell-specific cDNAs from the P19 mouse embryonal carcinoma cells. Its mRNA expression on the left side of the developing embryo earned the name “Lefty”. The human orthologue was initially identified as Ebaf, Endometrial bleeding associated factor. Lefty contains the six cysteine residues that are conserved among TGF- beta related proteins and that are necessary to form the cysteineknot structure. Its function in patterning left-right asymmetry of the developing organ systems such as the heart and lung is consistent in all vertebrate species examined. Lefty acts as an antagonist to Nodal signaling, potentially by competing for binding to a common receptor. It may play a role in endometrial bleeding.

Product Specifications

Gene Name

LEFTY2

Gene ID

7044

UniProt

O00292

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

LTGEQILGSLLQQLQLDQPPVLDKADVEGMVIPSHVRTQYVALLQHSHASRSRGKRHHHHHHFSQSFREVAGRFLASEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSAQARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLRDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAKNWVLEPPGFLAYECVGTCQQPPEALAFNWPFLGPRQCIASETASLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQP
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Cystatin C (CST3) Human Knockdown Lysate
LY300127 100 µg

Cystatin C (CST3) Human Knockdown Lysate

Ask
View Details
anti-TMEM49
YF-PA21177 50 ug

anti-TMEM49

Ask
View Details
Recombinant Human IL9 Protein, His Tag
KMH120 50 µg

Recombinant Human IL9 Protein, His Tag

Ask
View Details
Spare glass tube
1120185/3 1 Each

Spare glass tube

Ask
View Details
Human NOTCH2NL (Notch2 N-Terminal Like Protein) ELISA Kit
EH26780 96 Tests

Human NOTCH2NL (Notch2 N-Terminal Like Protein) ELISA Kit

Ask
View Details
CAPSL Human shRNA Plasmid Kit (Locus ID 133690)
TL305655 1 Kit

CAPSL Human shRNA Plasmid Kit (Locus ID 133690)

Ask
View Details