Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Left-right Determination Factor 2/Lefty-A (N-6His)

Source: Human Cells. MW :39.1kD. Recombinant Human Left-right Determination Factor 2 is produced by our Mammalian expression system and the target gene encoding Phe78-Pro366 is expressed fused with a Mouse Lefty-1 Propeptide (Leu22-Arg77) & 6His tag at the N-terminus. Left-right determination factor 2 (LEFTY2) is a secreted protein which belongs to the TGF-beta family. Lefty was first identified in a screen for undifferentiated cell-specific cDNAs from the P19 mouse embryonal carcinoma cells. Its mRNA expression on the left side of the developing embryo earned the name “Lefty”. The human orthologue was initially identified as Ebaf, Endometrial bleeding associated factor. Lefty contains the six cysteine residues that are conserved among TGF- beta related proteins and that are necessary to form the cysteineknot structure. Its function in patterning left-right asymmetry of the developing organ systems such as the heart and lung is consistent in all vertebrate species examined. Lefty acts as an antagonist to Nodal signaling, potentially by competing for binding to a common receptor. It may play a role in endometrial bleeding.

Product Specifications

Gene Name

LEFTY2

Gene ID

7044

UniProt

O00292

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

LTGEQILGSLLQQLQLDQPPVLDKADVEGMVIPSHVRTQYVALLQHSHASRSRGKRHHHHHHFSQSFREVAGRFLASEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSAQARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLRDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAKNWVLEPPGFLAYECVGTCQQPPEALAFNWPFLGPRQCIASETASLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MSL3L2 Double Nickase Plasmid (m)
sc-428561-NIC 20 µg

MSL3L2 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Anti-NOXA2/p67phox antibody
PAab05808 100 µg

Anti-NOXA2/p67phox antibody

Sign In for Pricing
View Details
CENPE Peptide
43-677P 0.1 mg

CENPE Peptide

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Sequestosome 1 (SQSTM1)
MBS2148564-01 0.1 mL

PE-Linked Monoclonal Antibody to Sequestosome 1 (SQSTM1)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Sequestosome 1 (SQSTM1)
MBS2148564-02 0.2 mL

PE-Linked Monoclonal Antibody to Sequestosome 1 (SQSTM1)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Sequestosome 1 (SQSTM1)
MBS2148564-03 0.5 mL

PE-Linked Monoclonal Antibody to Sequestosome 1 (SQSTM1)

Sign In for Pricing
View Details