Recombinant Mouse Cytotoxic T-lymphocyte Protein 4 (C-Flag)
Source: Human cells. MW :14.7kD. Recombinant Mouse Cytotoxic T-lymphocyte Protein 4 is produced by our Mammalian expression system and the target gene encoding Ala37-Asp161 is expressed with a Flag tag at the C-terminus. Mouse Cytotoxic Tlymphocyte 4 (CTLA-4, CD152), is a type I transmembrane T cell inhibitory molecule. Within the ECD, Mouse CTLA-4 shares 68% aa sequence identity with human. CTLA4 is similar to the T cell costimulatory protein CD28 since both of the molecules bind to CD80 and CD86 on antigen-presenting cells. CTLA4 transmits an inhibitory signal to T cells, whereas CD28 transmits a stimulatory signal. Intracellular CTLA4 is also found inregulatory T cells and may play an important role in their functions. T cell activation through the T cell receptor and CD28 leads to increased expression of CTLA4. Genetic variations of CTLA4 have been associated with susceptibility to systemic lupus erythematosus (SLE), Gravesdisease (GRD), Celiac disease type3 (CELIAC3) and Hepatitis B virus infection (HBVinfection) .
Product Specifications
Gene Name
Ctla4
Gene ID
12477
UniProt
P09793
Components
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
AIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSDDYKDDDDK
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items