Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cytotoxic T-lymphocyte Protein 4 (C-Flag)

Source: Human cells. MW :14.5kD. Recombinant Human Cytotoxic T-lymphocyte Protein 4 is produced by our Mammalian expression system and the target gene encoding Lys36-Asp161 is expressed with a Flag tag at the C-terminus. Cytotoxic Tlymphocyte 4 (CTLA-4, CD152), is a type I transmembrane T cell inhibitory molecule that is a member of the Ig superfamily. Human or mouse CTLA4 cDNA encodes 223 amino acids (aa) including a 35 aa signal sequence, a 126 aa extracellular domain (ECD) with one Ig-like V-type domain, a 21 aa transmembrane (TM) sequence, and a 41 aa cytoplasmic sequence.It is widely expressed with highest levels in lymphoid tissues. CD28 and CTLA-4, together with their ligands, B7-1 and B7-2, constitute one of the dominant costimulatory pathways that regulate T and B cell responses. CD28 and CTLA-4 are structurally homologous molecules that are members of the immunoglobulin (Ig) gene superfamily. CTLA4 transmits an inhibitory signal to T cells, whereas CD28 transmits a stimulatory signal. Intracellular CTLA4 is also found in regulatory T Cells and may play an important role in their functions. Tcell activation through the Tcell receptor and CD28 leads to increased expression of CTLA4.

Product Specifications

Gene Name

CTLA4

Gene ID

1493

UniProt

P16410

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

KAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDDYKDDDDK

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal TATA binding protein TBP Antibody [DyLight 650]
NBP2-98905C 0.1 mL

Rabbit Polyclonal TATA binding protein TBP Antibody [DyLight 650]

Sign In for Pricing
View Details
SV40 small T and large T antigen lentivirus (PGK, Puro) - SV40 small T and large T antigen lentivirus (PGK, Puro)
GTR15424370 25 µL (1x 25 µL)

SV40 small T and large T antigen lentivirus (PGK, Puro) - SV40 small T and large T antigen lentivirus (PGK, Puro)

Sign In for Pricing
View Details
Vinculin, NT (VCL, VINC, CMD1W, CMH15, Metavinculin, MVCL) (MaxLight 550)
MBS6505812-01 0.1 mL

Vinculin, NT (VCL, VINC, CMD1W, CMH15, Metavinculin, MVCL) (MaxLight 550)

Sign In for Pricing
View Details
Vinculin, NT (VCL, VINC, CMD1W, CMH15, Metavinculin, MVCL) (MaxLight 550)
MBS6505812-02 5x 0.1 mL

Vinculin, NT (VCL, VINC, CMD1W, CMH15, Metavinculin, MVCL) (MaxLight 550)

Sign In for Pricing
View Details
Nme4 (NM_001109478) Rat Tagged ORF Clone Lentiviral Particle
RR214915L3V 200 µL

Nme4 (NM_001109478) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
KCNN3 Protein Vector (Mouse) (pPB-C-His)
PV193746 500 ng

KCNN3 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details