Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Inducible T-cell Costimulator/ICOS (C-6His)

Source: Human cells. MW :14.7kD. Recombinant Mouse Inducible T-cell Costimulator is produced by our Mammalian expression system and the target gene encoding Glu21-Leu142 is expressed with a 6His tag at the C-terminus. Inducible Costimulator (ICOS) is a member of the growing CD28 family of immune costimulatory receptors. Other family members are CD28, CTLA4 and PD1. ICOS shares approximately 39% amino acid similarity with CD 28 and CTLA4. Mouse and human ICOS share approximately 72% amino acid identity. ICOS is expressed on most CD45RO+ cells. ICOS expression is up-regulated within approximately 24-48 hours of activation on Th primed cells. B7-H2, a member of the B7 family of costimulatory ligands, has been identified as the ICOS ligand. The B7-H2/ ICOS interaction appears to play roles in T cell dependent B cell activation and Th differentiation. In addition, ICOS is more potent in the induction of IL-10 production, acytokine important for suppressive function of T regulatory cells.

Product Specifications

Gene Name

Icos

Gene ID

54167

UniProt

Q9WVS0

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

EINGSADHRMFSFHNGGVQISCKYPETVQQLKMRLFREREVLCELTKTKGSGNAVSIKNPMLCLYHLSNNSVSFFLNNPDSSQGSYYFCSLSIFDPPPFQERNLSGGYLHIYESQLCCQLKLHHHHHH

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) THOC6 Polyclonal Antibody
MBS7196023 Inquire

Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) THOC6 Polyclonal Antibody

Sign In for Pricing
View Details
IFN-yRa (Interferon gamma Receptor 1, IFN-gamma Receptor 1, IFN-gamma-R1, CDw119, CD119, IFNGR1)
223474 50 µL

IFN-yRa (Interferon gamma Receptor 1, IFN-gamma Receptor 1, IFN-gamma-R1, CDw119, CD119, IFNGR1)

Sign In for Pricing
View Details
SLC22A2 (Solute Carrier Family 22 Member 2, Organic Cation Transporter 2, hOCT2, OCT2, MGC32628) (Biotin) discontinued
133424-Biotin 100 µL

SLC22A2 (Solute Carrier Family 22 Member 2, Organic Cation Transporter 2, hOCT2, OCT2, MGC32628) (Biotin) discontinued

Sign In for Pricing
View Details
PTPA Antibody
abx037883-01 100 µg

PTPA Antibody

Sign In for Pricing
View Details
PTPA Antibody
abx037883-02 1 mg

PTPA Antibody

Sign In for Pricing
View Details
Bovine Cytb561 ELISA Kit
EBC0879 96 Tests

Bovine Cytb561 ELISA Kit

Sign In for Pricing
View Details