Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Inducible T-cell Costimulator/ICOS (C-6His)

Source: Human cells. MW :14.7kD. Recombinant Mouse Inducible T-cell Costimulator is produced by our Mammalian expression system and the target gene encoding Glu21-Leu142 is expressed with a 6His tag at the C-terminus. Inducible Costimulator (ICOS) is a member of the growing CD28 family of immune costimulatory receptors. Other family members are CD28, CTLA4 and PD1. ICOS shares approximately 39% amino acid similarity with CD 28 and CTLA4. Mouse and human ICOS share approximately 72% amino acid identity. ICOS is expressed on most CD45RO+ cells. ICOS expression is up-regulated within approximately 24-48 hours of activation on Th primed cells. B7-H2, a member of the B7 family of costimulatory ligands, has been identified as the ICOS ligand. The B7-H2/ ICOS interaction appears to play roles in T cell dependent B cell activation and Th differentiation. In addition, ICOS is more potent in the induction of IL-10 production, acytokine important for suppressive function of T regulatory cells.

Product Specifications

Gene Name

Icos

Gene ID

54167

UniProt

Q9WVS0

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

EINGSADHRMFSFHNGGVQISCKYPETVQQLKMRLFREREVLCELTKTKGSGNAVSIKNPMLCLYHLSNNSVSFFLNNPDSSQGSYYFCSLSIFDPPPFQERNLSGGYLHIYESQLCCQLKLHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Alkyne-PEG5-N3
MD007006-5 Inquire

Alkyne-PEG5-N3

Ask
View Details
Hsp105 Recombinant Rabbit mAb
E43S47973 100 µL

Hsp105 Recombinant Rabbit mAb

Ask
View Details
Lentiviral human ZNF768 sgRNA gene knockout kit - Lentiviral human ZNF768 sgRNA gene knockout kit (100)
GTR15362929 1 Vial

Lentiviral human ZNF768 sgRNA gene knockout kit - Lentiviral human ZNF768 sgRNA gene knockout kit (100)

Ask
View Details
MEK1/2  (Phospho-Ser217+  Ser221)  Antibody
ABF8035 100 µg

MEK1/2 (Phospho-Ser217+ Ser221) Antibody

Ask
View Details
ADFP (PLIN2) Rabbit Polyclonal Antibody
TA371265 100 µL

ADFP (PLIN2) Rabbit Polyclonal Antibody

Ask
View Details
RAB11FIP1 (NM_001002814) Human Tagged Lenti ORF Clone
RC214680L3 10 µg

RAB11FIP1 (NM_001002814) Human Tagged Lenti ORF Clone

Ask
View Details