Recombinant Mouse Inducible T-cell Costimulator/ICOS (C-6His)
Source: Human cells. MW :14.7kD. Recombinant Mouse Inducible T-cell Costimulator is produced by our Mammalian expression system and the target gene encoding Glu21-Leu142 is expressed with a 6His tag at the C-terminus. Inducible Costimulator (ICOS) is a member of the growing CD28 family of immune costimulatory receptors. Other family members are CD28, CTLA4 and PD1. ICOS shares approximately 39% amino acid similarity with CD 28 and CTLA4. Mouse and human ICOS share approximately 72% amino acid identity. ICOS is expressed on most CD45RO+ cells. ICOS expression is up-regulated within approximately 24-48 hours of activation on Th primed cells. B7-H2, a member of the B7 family of costimulatory ligands, has been identified as the ICOS ligand. The B7-H2/ ICOS interaction appears to play roles in T cell dependent B cell activation and Th differentiation. In addition, ICOS is more potent in the induction of IL-10 production, acytokine important for suppressive function of T regulatory cells.
Product Specifications
Gene Name
Icos
Gene ID
54167
UniProt
Q9WVS0
Components
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
EINGSADHRMFSFHNGGVQISCKYPETVQQLKMRLFREREVLCELTKTKGSGNAVSIKNPMLCLYHLSNNSVSFFLNNPDSSQGSYYFCSLSIFDPPPFQERNLSGGYLHIYESQLCCQLKLHHHHHH
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items