Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse C-C motif Chemokine 8/CCL8/MCP-2 (C-6His)

Source: Human Cells. MW :9.8kD. Recombinant Mouse C-C motif Chemokine 8 is produced by our expression system and the target gene encoding Glu20-Pro97 is expressed Chemokine ligand 8 (CCL8, MCP-2), is a small secreted cytokine which belongs to the intercrine beta (chemokine CC) family. CCL8 Chemotactic factor attracts monocytes. It can bind heparin.CCL8 functions to activate different immune cells, including mast cells, eosinophils and basophils which are involved in allergic responses, monocytes, and T cells and NK cells which are involved in the inflammatory response. Its ability achieves by binding to different cell surface receptors termed chemokine receptors including CCR1, CCR2B and CCR5. It has been reported that CCL8 is a potent inhibitor of HIV-1 by virtue of its binding to CCR5 which is one of the major co-receptors for HIV-1.

Product Specifications

Gene Name

Ccl8

Gene ID

20307

UniProt

Q9Z121

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

EKLTGPDKAPVTCCFHVLKLKIPLRVLKSYERINNIQCPMEAVVFQTKQGMSLCVDPTQKWVSEYMEILDQKSQILQPHHHHHH

More Discoveries

Explore Other Products

Browse additional items from our catalog

NOTCH1 Rabbit Polyclonal Antibody
TA379227 100 µL

NOTCH1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Rhizobium loti Glutamate--tRNA ligase 2 (gltX2)
MBS1316696-01 0.02 mg (E-Coli)

Recombinant Rhizobium loti Glutamate--tRNA ligase 2 (gltX2)

Sign In for Pricing
View Details
Recombinant Rhizobium loti Glutamate--tRNA ligase 2 (gltX2)
MBS1316696-02 0.02 mg (Yeast)

Recombinant Rhizobium loti Glutamate--tRNA ligase 2 (gltX2)

Sign In for Pricing
View Details
Recombinant Rhizobium loti Glutamate--tRNA ligase 2 (gltX2)
MBS1316696-03 0.1 mg (E-Coli)

Recombinant Rhizobium loti Glutamate--tRNA ligase 2 (gltX2)

Sign In for Pricing
View Details
Recombinant Rhizobium loti Glutamate--tRNA ligase 2 (gltX2)
MBS1316696-04 0.1 mg (Yeast)

Recombinant Rhizobium loti Glutamate--tRNA ligase 2 (gltX2)

Sign In for Pricing
View Details
Recombinant Rhizobium loti Glutamate--tRNA ligase 2 (gltX2)
MBS1316696-05 0.02 mg (Baculovirus)

Recombinant Rhizobium loti Glutamate--tRNA ligase 2 (gltX2)

Sign In for Pricing
View Details