Recombinant Mouse C-C motif Chemokine 8/CCL8/MCP-2 (C-6His)
Source: Human Cells. MW :9.8kD. Recombinant Mouse C-C motif Chemokine 8 is produced by our expression system and the target gene encoding Glu20-Pro97 is expressed Chemokine ligand 8 (CCL8, MCP-2), is a small secreted cytokine which belongs to the intercrine beta (chemokine CC) family. CCL8 Chemotactic factor attracts monocytes. It can bind heparin.CCL8 functions to activate different immune cells, including mast cells, eosinophils and basophils which are involved in allergic responses, monocytes, and T cells and NK cells which are involved in the inflammatory response. Its ability achieves by binding to different cell surface receptors termed chemokine receptors including CCR1, CCR2B and CCR5. It has been reported that CCL8 is a potent inhibitor of HIV-1 by virtue of its binding to CCR5 which is one of the major co-receptors for HIV-1.
Product Specifications
Gene Name
Ccl8
Gene ID
20307
UniProt
Q9Z121
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
EKLTGPDKAPVTCCFHVLKLKIPLRVLKSYERINNIQCPMEAVVFQTKQGMSLCVDPTQKWVSEYMEILDQKSQILQPHHHHHH
Explore Other Products
Browse additional items from our catalog