Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tumor Necrosis Factor Receptor Superfamily Member 5/CD40 (C-6His)

Source: Human cells. MW :20.2kD. Recombinant Mouse Tumor Necrosis Factor Receptor Superfamily Member 5 is produced by our Mammalian expression system and the target gene encoding Leu20-Arg193 is expressed with a 6His tag at the C-terminus. CD40 is a Type I Transmembrane Glycoprotein that belongs to the TNF Receptor Superfamily. CD40 is expressed in B cells, follicular dendritic cells, dendritic cells, activated monocytes, macrophages, endothelial cells, vascular smooth muscle cells, and several tumor cell lines. The extracellular domain of CD40 is characterized by Cysteine rich repeat regions. Interaction of CD40 with its ligand (CD40L) leads to aggregation of CD40 molecules, which in turn interact with cytoplasmic components to initiate signaling pathways. Several different TRAF proteins (adaptor proteins) have been identified to serves as mediators of the signal transduction. CD40 plays an essential role in mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation.

Product Specifications

Gene Name

Cd40

Gene ID

21939

UniProt

P27512

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

LGQCVTCSDKQYLHDGQCCDLCQPGSRLTSHCTALEKTQCHPCDSGEFSAQWNREIRCHQHRHCEPNQGLRVKKEGTAESDTVCTCKEGQHCTSKDCEACAQHTPCIPGFGVMEMATETTDTVCHPCPVGFFSNQSSLFEKCYPWTSCEDKNLEVLQKGTSQTNVICGLKSRMRHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal Kirrel3/NEPH2 Antibody [Alexa Fluor 594]
NBP2-98153AF594 0.1 mL

Rabbit Polyclonal Kirrel3/NEPH2 Antibody [Alexa Fluor 594]

Ask
View Details
BCMP11 Polyclonal Antibody, APC-Cy7 Conjugated
bs-6508R-APC-Cy7 100 µL

BCMP11 Polyclonal Antibody, APC-Cy7 Conjugated

Ask
View Details
Trmt2b (NM_001167995) Mouse Tagged Lenti ORF Clone
MR219051L3 10 µg

Trmt2b (NM_001167995) Mouse Tagged Lenti ORF Clone

Ask
View Details
Mouse Monoclonal ETS2 Antibody (PCRP-ETS2-1D9) [Allophycocyanin]
NBP3-14209APC 0.1 mL

Mouse Monoclonal ETS2 Antibody (PCRP-ETS2-1D9) [Allophycocyanin]

Ask
View Details