Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human B7 Homolog 6/B7-H6/NCR3LG1 (C-6His)

Source: Human cells. MW :27.5kD. Recombinant Human B7 Homolog 6 is produced by our Mammalian expression system and the target gene encoding Asp25-Ser262 is expressed with a 6His tag at the C-terminus. Natural cytotoxicity triggering receptor 3 ligand 1 (B7-H6) is a glycosylated member of the B7 family of immune costimulatory proteins. Mature human B7-H6 consists of a 238 amino acid (aa) extracellular domain (ECD) that contains one Ig-like V domain and one Ig-like C1 domain, a 21 aa transmembrane segment, and a 171 aa cytoplasmic domain that contains one ITIM, one SH2, and one SH3 motif. Both of the Ig-like domains carry N-linked glycosylation. The Ig-like V domain mediates 1:1 stoichiometric binding of B7-H6 to NKp30 expressed on NK cells. It does not show binding to NKp44, NKp46, or NKG2D. Ligation of NKp30 by B7-H6 induces NK cell activation and target cell cytolysis. B7-H6 is expressed on a wide range of hematopoietic, carcinoma, and melanoma tumor cells, which is consistent with the detection of NKp30 binding sites on many tumors.

Product Specifications

Gene Name

NCR3LG1

Gene ID

374383

UniProt

Q68D85

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

DLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDKEVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVASPASRLLLDQVGMKENEDKYMCESSGFYPEAINITWEKQTQKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGTVYQCVVRHASLHTPLRSNFTLTAARHSLSETEKTDNFSHHHHHH
More Discoveries

Explore Other Products

Browse additional items from our catalog

PKA alpha CAT (pS338) Antibody
abx217933 100 µg

PKA alpha CAT (pS338) Antibody

Sign In for Pricing
View Details
Anti-CCN1 Antibody
MBS178382-01 0.01 mg

Anti-CCN1 Antibody

Sign In for Pricing
View Details
Anti-CCN1 Antibody
MBS178382-02 0.1 mg (Carrier Free)

Anti-CCN1 Antibody

Sign In for Pricing
View Details
Anti-CCN1 Antibody
MBS178382-03 0.1 mg

Anti-CCN1 Antibody

Sign In for Pricing
View Details
Anti-CCN1 Antibody
MBS178382-04 0.1 mg (Cy3)

Anti-CCN1 Antibody

Sign In for Pricing
View Details
Anti-CCN1 Antibody
MBS178382-05 0.1 mg (Biotin)

Anti-CCN1 Antibody

Sign In for Pricing
View Details