Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse TNF ligand superfamily member 9/TNFSF9 (N-10His)

Source: Human cells. MW :25.6kD. Recombinant Mouse 4-1BB Ligand is produced by our Mammalian expression system and the target gene encoding Arg104-Glu309 is expressed with a 10His tag at the N-terminus. Tumor necrosis factor ligand superfamily member 9, also known as 4-1BBL, is a member of the the tumor necrosis factor family. Mouse 4-1BBL cDNA encodes a 309 amino acid residues (aa) protein with an 82 aa N-terminal cytoplasmic domain, a 21 aa transmembrane domain and a 206 aa C-terminal extracellular domain. The extracellular domain of 4-1BBL has a tertiary structure similar to that of other TNFSF members, but shares only low aa sequence homology (14-16%) . 4-1BBL is predominantly expressed on activated antigen presenting cells (APCs) such as B cells, macrophages and dendritic cells (DCs) . It is also expressed on most T and B lymphoma cell lines. TNFSF9 has been shown to reactivate anergic T lymphocytes in addition to promoting T lymphocyte proliferation. This cytokine has also been shown to be required for the optimal CD8 responses in CD8 T cells, and is thought to be involved in T cell-tumor cell interaction.

Product Specifications

Gene Name

Tnfsf9

Gene ID

21950

UniProt

P41274

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

HHHHHHHHHHGGGSGGGSGGGSIEGRRTEPRPALTITTSPNLGTRENNADQVTPVSHIGCPNTTQQGSPVFAKLLAKNQASLCNTTLNWHSQDGAGSSYLSQGLRYEEDKKELVVDSPGLYYVFLELKLSPTFTNTGHKVQGWVSLVLQAKPQVDDFDNLALTVELFPCSMENKLVDRSWSQLLLLKAGHRLSVGLRAYLHGAQDAYRDWELSYPNTTSFGLFLVKPDNPWE
More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC124 Protein Vector (Rat) (pPM-C-HA)
PV257856 500 ng

CCDC124 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Med21 (NM_025315) Mouse Recombinant Protein
PM48843M5 20 µg

Med21 (NM_025315) Mouse Recombinant Protein

Sign In for Pricing
View Details
Xpnpep3 (NM_001130582) Rat Untagged Clone
RN212946 10 µg

Xpnpep3 (NM_001130582) Rat Untagged Clone

Sign In for Pricing
View Details
FceRI, alpha (Fc epsilon RI, IgE Receptor) (MaxLight 550)
MBS6245811-01 0.1 mL

FceRI, alpha (Fc epsilon RI, IgE Receptor) (MaxLight 550)

Sign In for Pricing
View Details
FceRI, alpha (Fc epsilon RI, IgE Receptor) (MaxLight 550)
MBS6245811-02 5x 0.1 mL

FceRI, alpha (Fc epsilon RI, IgE Receptor) (MaxLight 550)

Sign In for Pricing
View Details
SOX9 (pS181) Antibody
abx009819-01 30 µL

SOX9 (pS181) Antibody

Sign In for Pricing
View Details