Recombinant Mouse IAP/OA3/CD47 (C-6His)
Source: Human Cells. MW :16.7kD. Recombinant Mouse Leukocyte surface antigen CD47 is produced by our Mammalian expression system and the target gene encoding Gln19-Pro158 is expressed with a 6His tag at the C-terminus. CD47 is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The protein is also a receptor for the C-terminal cell-binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This protein has broad tissue distribution, and is reduced in expression on Rh erythrocytes.
Product Specifications
Gene Name
Cd47
Gene ID
16423
UniProt
Q61735
Components
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTAFNTDQGSACSYEEEKGGCKLVSWFSPVDHHHHHH
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items