Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse IAP/OA3/CD47 (C-6His)

Source: Human Cells. MW :16.7kD. Recombinant Mouse Leukocyte surface antigen CD47 is produced by our Mammalian expression system and the target gene encoding Gln19-Pro158 is expressed with a 6His tag at the C-terminus. CD47 is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The protein is also a receptor for the C-terminal cell-binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This protein has broad tissue distribution, and is reduced in expression on Rh erythrocytes.

Product Specifications

Gene Name

Cd47

Gene ID

16423

UniProt

Q61735

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTAFNTDQGSACSYEEEKGGCKLVSWFSPVDHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CAB39 (NM_001130849) Human Over-expression Lysate
LC427286 20 µg

CAB39 (NM_001130849) Human Over-expression Lysate

Ask
View Details
Cavy Acyl-Coenzyme A Synthetase ACSM4, Mitochondrial (ACSM4) ELISA Kit
MBS9356545 Inquire

Cavy Acyl-Coenzyme A Synthetase ACSM4, Mitochondrial (ACSM4) ELISA Kit

Ask
View Details
C3orf15 (MAATS1) (NM_033364) Human Recombinant Protein
TP321319L 1 mg

C3orf15 (MAATS1) (NM_033364) Human Recombinant Protein

Ask
View Details
Rat Monoclonal TIM-2 Antibody (RM0134-5B23) [Alexa Fluor 350]
NBP1-22510AF350 0.1 mL

Rat Monoclonal TIM-2 Antibody (RM0134-5B23) [Alexa Fluor 350]

Ask
View Details
THEG Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
46646061 1.0 µg DNA

THEG Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Ask
View Details
IKZF3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4C9]
TA804411BM 100 µL

IKZF3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4C9]

Ask
View Details