Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Fc gamma RIIIA/FCGR3/CD16 (C-6His)

Source: Human cells. MW :22kD. Recombinant Mouse Low affinity IgG Fc receptor III is produced by our Mammalian expression system and the target gene encoding Ala31-Thr215 is expressed with a 6His tag at the C-terminus. Low affinity immunoglobulin gamma Fc region receptor III (Fc gamma RIII/CD16) is a member of the Ig superfamily. Based on close relationships in their extracellular domains, the Fc gamma Rs have been divided into three classes composing of Fc gamma RI (CD64), Fc gamma RII (CD32), and Fc gamma RIII (CD16) . Each group may be encoded by multiple genes and exist in different isoforms depending on species and cell type. Mouse CD16 is a type I transmembrane protein having two extracellular Ig-like domains consisting of immunoglobulin domain, repeat, signa and transmembrane, transmembrane helix. It is expressed on a variety of myeloid and lymphoid cells and associates with Fc R gamma to deliver an activating signal upon ligand binding. Fcgr3 is IgG binding and activation or inhibition of immune responses such as antibody-dependent cellular cytotoxicity, phagocytosis, cell surface receptor signaling pathway and positive regulation of type I/IIa/III hypersensitivity.

Product Specifications

Gene Name

Fcgr3

UniProt

P08508

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.5.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

ALPKAVVKLDPPWIQVLKEDMVTLMCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHSHSGDYYCKGSLGSTQHQSKPVTITVQDPATTSSISLVWYHTHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL
BNC740158-500 1x 500 µL

Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL
BNC880525-100 1x 100 µL

CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF594 conjugate, 0.1mg/mL
BNC940977-100 1x 100 µL

TGF-beta (1D11.16.8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF405S conjugate, 0.1mg/mL
BNC040391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF568 conjugate, 0.1mg/mL
BNC680043-100 1x 100 µL

P21 / WAF1 (WA-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details