Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse SLAMF4/Natural killer cell receptor 2B4/CD244 (C-6His)

Source: Human cells. MW :23.5kD. Recombinant Mouse Natural killer cell receptor 2B4 is produced by our Mammalian expression system and the target gene encoding Gln20-Asn221 is expressed with a 6His tag at the C-terminus. Natural killer cell receptor 2B4 (2B4/CD244) is is a 66 kDa type I transmembrane glycoprotein in the SLAM subgroup of the CD2 protein family. SLAM family proteins have an extracellular domain (ECD) with two or four Ig-like domains and at least two cytoplasmic immunoreceptor tyrosine-based switch motifs (ITSMs) . 2B4 interacts with CD48, while other SLAM family proteins interact in a homophilic manner. The mouse 2B4 cDNA encodes a 397 amino acid (aa) precursor that includes a 19 aa signal sequence, a 207 aa ECD with one Ig-like V-type and one C2-type Ig-like domain, a 21 aa transmembrane segment, and a 150 aa cytoplasmic domain with four ITSMs. Within the ECD, mouse 2B4 shares 46% and 68% aa sequence identity with human and rat 2B4, respectively. 2B4/CD48 signaling cooperates with other receptor systems to either promote or inhibit NK and CD8+ T cell activation. The inhibitory activities are distinct from those of MHC I restricted inhibitory NK cell receptors. Ligation of 2B4 with antibodies or CD48 constructs can directly trigger inhibitory signaling or disrupt an inhibitory interaction, leading to cellular activation. 2B4 can also induce signaling through CD48.

Product Specifications

Gene Name

Cd244

Gene ID

18106

UniProt

Q07763

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

QDCPDSSEEVVGVSGKPVQLRPSNIQTKDVSVQWKKTEQGSHRKIEILNWYNDGPSWSNVSFSDIYGFDYGDFALSIKSAKLQDSGHYLLEITNTGGKVCNKNFQLLILDHVETPNLKAQWKPWTNGTCQLFLSCLVTKDDNVSYALYRGSTLISNQRNSTHWENQIDASSLHTYTCNVSNRASWANHTLNFTHGCQSVPSNHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human Laminin-5 (LN-5) ELISA Kit
YP-W16941-01 48 Tests

Human Laminin-5 (LN-5) ELISA Kit

Ask
View Details
Human Laminin-5 (LN-5) ELISA Kit
YP-W16941-02 96 Tests

Human Laminin-5 (LN-5) ELISA Kit

Ask
View Details
Wdr98 (NM_001009638) Rat Tagged ORF Clone
RR208870 10 µg

Wdr98 (NM_001009638) Rat Tagged ORF Clone

Ask
View Details
Ddx19b (NM_001190786) Mouse Tagged Lenti ORF Clone
MR222232L3 10 µg

Ddx19b (NM_001190786) Mouse Tagged Lenti ORF Clone

Ask
View Details
ELMOD2 discontinued
509120 100 µg

ELMOD2 discontinued

Ask
View Details